Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTVKHT23)

• DOT Name: NK1 transcription factor-related protein 2 (NKX1-2)
• Synonyms: Homeobox protein SAX-1; NKX-1.1
• Gene Name: NKX1-2
• UniProt ID: NKX12_HUMAN
• Pfam ID: PF00046
• Sequence:
  MLAWQDGGAKAAPSHHKISFSVLDILDPQKFTRAALPAVRPAPREARKSLAEVEAGKDAS
  SRDPVRQLETPDAAGPGAGQASPLEGSEAEEEEDAEDPRRPRLRERAARLLPGLARSPDA
  PAGALASGEPCEDGGGGPVRSPPGSPGSPRPRRRRLEPNCAKPRRARTAFTYEQLVALEN
  KFRATRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQNPGADGAAQVGGGAPQPGA
  AGGGGGGGSGGSPGPPGTGALHFQTFPSYSAANVLFPSAASFPLTAAAPGSPFAPFLGPS
  YLTPFYAPRL
• Function: May function in cell specification, particularly in the CNS.

Molecular Interaction Atlas (MIA) of This DOT

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of NK1 transcription factor-related protein 2 (NKX1-2).	[1]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of NK1 transcription factor-related protein 2 (NKX1-2).	[2]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the phosphorylation of NK1 transcription factor-related protein 2 (NKX1-2).	[3]

References

• [1] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [2] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [3] Phosphoproteomics reveals resveratrol-dependent inhibition of Akt/mTORC1/S6K1 signaling. J Proteome Res. 2014 Dec 5;13(12):5734-42. doi: 10.1021/pr500714a. Epub 2014 Oct 29.