General Information of Drug Off-Target (DOT) (ID: OTVL01TR)

DOT Name Phospholipid phosphatase-related protein type 5 (PLPPR5)
Synonyms Lipid phosphate phosphatase-related protein type 5; Phosphatidic acid phosphatase type 2d; Plasticity-related gene 5 protein; PRG-5
Gene Name PLPPR5
Related Disease
Breast cancer ( )
Breast carcinoma ( )
Cervical carcinoma ( )
UniProt ID
PLPR5_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF01569
Sequence
MPLLPAALTSSMLYFQMVIMAGTVMLAYYFEYTDTFTVNVQGFFCHDSAYRKPYPGPEDS
SAVPPVLLYSLAAGVPVLVIIVGETAVFCLQLATRDFENQEKTILTGDCCYINPLVRRTV
RFLGIYTFGLFATDIFVNAGQVVTGNLAPHFLALCKPNYTALGCQQYTQFISGEEACTGN
PDLIMRARKTFPSKEAALSVYAAMYLTMYITNTIKAKGTRLAKPVLCLGLMCLAFLTGLN
RVAEYRNHWSDVIAGFLVGISIAVFLVVCVVNNFKGRQAENEHIHMDNLAQMPMISIPRV
ESPLEKVTSVQNHITAFAEVT
Function Induces filopodia formation and promotes neurite growth in a CDC42-independent manner; impedes neurite growth inhibitory-mediated axonal retraction.
Tissue Specificity Isoform 1 is expressed in brain, lung, kidney and colon. Isoform 2 is expressed in placenta, skeletal muscle and kidney.
Reactome Pathway
Lysosphingolipid and LPA receptors (R-HSA-419408 )

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Breast cancer DIS7DPX1 Strong Biomarker [1]
Breast carcinoma DIS2UE88 Strong Biomarker [1]
Cervical carcinoma DIST4S00 moderate Biomarker [2]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Arsenic trioxide DM61TA4 Approved Arsenic trioxide decreases the expression of Phospholipid phosphatase-related protein type 5 (PLPPR5). [3]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of Phospholipid phosphatase-related protein type 5 (PLPPR5). [4]
SNDX-275 DMH7W9X Phase 3 SNDX-275 increases the expression of Phospholipid phosphatase-related protein type 5 (PLPPR5). [5]
------------------------------------------------------------------------------------
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Phospholipid phosphatase-related protein type 5 (PLPPR5). [6]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the methylation of Phospholipid phosphatase-related protein type 5 (PLPPR5). [7]
Octanal DMTN0OK Investigative Octanal increases the methylation of Phospholipid phosphatase-related protein type 5 (PLPPR5). [8]
------------------------------------------------------------------------------------

References

1 Site-directed mutagenesis of the arginine-glycine-aspartic acid sequence in osteopontin destroys cell adhesion and migration functions.J Cell Biochem. 1995 Apr;57(4):680-90. doi: 10.1002/jcb.240570413.
2 New approach to human high-risk papillomavirus (HR-HPV) genotyping.Neoplasma. 2002;49(4):217-24.
3 Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
4 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
5 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
6 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
7 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
8 DNA Methylome Analysis of Saturated Aliphatic Aldehydes in Pulmonary Toxicity. Sci Rep. 2018 Jul 12;8(1):10497. doi: 10.1038/s41598-018-28813-z.