Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTWG32MT)

• DOT Name: T-cell antigen CD7 (CD7)
• Synonyms: GP40; T-cell leukemia antigen; T-cell surface antigen Leu-9; TP41; CD antigen CD7
• Gene Name: CD7
• UniProt ID: CD7_HUMAN
• Pfam ID: PF07686
• Sequence:
  MAGPPRLLLLPLLLALARGLPGALAAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLR
  QLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEV
  NVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP
  AALAVISFLLGLGLGVACVLARTQIKKLCSWRDKNSAACVVYEDMSHSRCNTLSSPNQYQ
• Function: Not yet known.
• KEGG Pathway: Hematopoietic cell lineage (hsa04640)

Molecular Interaction Atlas (MIA) of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of T-cell antigen CD7 (CD7).	[1]

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of T-cell antigen CD7 (CD7).	[2]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of T-cell antigen CD7 (CD7).	[3]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of T-cell antigen CD7 (CD7).	[4]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of T-cell antigen CD7 (CD7).	[4]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of T-cell antigen CD7 (CD7).	[5]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of T-cell antigen CD7 (CD7).	[6]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of T-cell antigen CD7 (CD7).	[7]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the expression of T-cell antigen CD7 (CD7).	[8]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [3] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [4] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [5] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [6] Benzo[a]pyrene-induced changes in microRNA-mRNA networks. Chem Res Toxicol. 2012 Apr 16;25(4):838-49.
• [7] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [8] Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.