Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTWSH0J8)

DOT Name Transmembrane emp24 domain-containing protein 1 (TMED1)
Synonyms Interleukin-1 receptor-like 1 ligand; Putative T1/ST2 receptor-binding protein; p24 family protein gamma-1; Tp24; p24gamma1
Gene Name TMED1
Related Disease
HIV infectious disease ( )
UniProt ID
TMED1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
7RRM
Pfam ID
PF01105
Sequence
MMAAGAALALALWLLMPPVEVGGAGPPPIQDGEFTFLLPAGRKQCFYQSAPANASLETEY
QVIGGAGLDVDFTLESPQGVLLVSESRKADGVHTVEPTEAGDYKLCFDNSFSTISEKLVF
FELIFDSLQDDEEVEGWAEAVEPEEMLDVKMEDIKESIETMRTRLERSIQMLTLLRAFEA
RDRNLQEGNLERVNFWSAVNVAVLLLVAVLQVCTLKRFFQDKRPVPT
Function
Potential role in vesicular protein trafficking, mainly in the early secretory pathway. May act as a cargo receptor at the lumenal side for incorporation of secretory cargo molecules into transport vesicles and may be involved in vesicle coat formation at the cytoplasmic side. Plays a positive role in IL-33-mediated IL-8 and IL-6 production by interacting with interleukin-33 receptor IL1RL1. Also plays a role in the modulation of innate immune signaling through the cGAS-STING pathway by interacting with RNF26.
Tissue Specificity Widely expressed.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
HIV infectious disease DISO97HC Strong Altered Expression [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
4 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Transmembrane emp24 domain-containing protein 1 (TMED1). [2]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Transmembrane emp24 domain-containing protein 1 (TMED1). [3]
Vorinostat DMWMPD4 Approved Vorinostat decreases the expression of Transmembrane emp24 domain-containing protein 1 (TMED1). [4]
Cytarabine DMZD5QR Approved Cytarabine decreases the expression of Transmembrane emp24 domain-containing protein 1 (TMED1). [5]
------------------------------------------------------------------------------------

References

1 Human IL-18 receptor and ST2L are stable and selective markers for the respective type 1 and type 2 circulating lymphocytes.J Immunol. 2001 Aug 1;167(3):1238-44. doi: 10.4049/jimmunol.167.3.1238.
2 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
3 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
4 A genomic approach to predict synergistic combinations for breast cancer treatment. Pharmacogenomics J. 2013 Feb;13(1):94-104. doi: 10.1038/tpj.2011.48. Epub 2011 Nov 15.
5 Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.