Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTX6T4I6)

• DOT Name: Cytidine and dCMP deaminase domain-containing protein 1 (CDADC1)
• Synonyms: EC 3.5.4.5; Cytidine deaminase; Testis development protein NYD-SP15
• Gene Name: CDADC1
• UniProt ID: CDAC1_HUMAN
• EC Number: 3.5.4.5
• Pfam ID: PF00383
• Sequence:
  MKEAGQMQNLESARAGRSVSTQTGSMTGQIPRLSKVNLFTLLSLWMELFPAEAQRQKSQK
  NEEGKHGPLGDNEERTRVSTDKRQVKRTGLVVVKNMKIVGLHCSSEDLHAGQIALIKHGS
  RLKNCDLYFSRKPCSACLKMIVNAGVNRISYWPADPEISLLTEASSSEDAKLDAKAVERL
  KSNSRAHVCVLLQPLVCYMVQFVEETSYKCDFIQKITKTLPDANTDFYYECKQERIKEYE
  MLFLVSNEEMHKQILMTIGLENLCENPYFSNLRQNMKDLILLLATVASSVPNFKHFGFYR
  SNPEQINEIHNQSLPQEIARHCMVQARLLAYRTEDHKTGVGAVIWAEGKSRSCDGTGAMY
  FVGCGYNAFPVGSEYADFPHMDDKQKDREIRKFRYIIHAEQNALTFRCQEIKPEERSMIF
  VTKCPCDECVPLIKGAGIKQIYAGDVDVGKKKADISYMRFGELEGVSKFTWQLNPSGAYG
  LEQNEPERRENGVLRPVPQKEEQHQDKKLRLGIH
• Function: Catalyzes the deamination of cytidine and deoxycytidine into uridine and deoxyuridine, respectively. May play an important role in testicular development and spermatogenesis.
• Tissue Specificity: Widely expressed. Expressed at high levels in the testis.

Molecular Interaction Atlas (MIA) of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Cytidine and dCMP deaminase domain-containing protein 1 (CDADC1).	[1]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Cytidine and dCMP deaminase domain-containing protein 1 (CDADC1).	[7]

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Cytidine and dCMP deaminase domain-containing protein 1 (CDADC1).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Cytidine and dCMP deaminase domain-containing protein 1 (CDADC1).	[3]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Cytidine and dCMP deaminase domain-containing protein 1 (CDADC1).	[4]
Arsenic	DMTL2Y1	Approved	Arsenic affects the expression of Cytidine and dCMP deaminase domain-containing protein 1 (CDADC1).	[5]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Cytidine and dCMP deaminase domain-containing protein 1 (CDADC1).	[6]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Cytidine and dCMP deaminase domain-containing protein 1 (CDADC1).	[8]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [3] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [4] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [5] Drinking-water arsenic exposure modulates gene expression in human lymphocytes from a U.S. population. Environ Health Perspect. 2008 Apr;116(4):524-31. doi: 10.1289/ehp.10861.
• [6] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [7] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [8] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.