Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTX7ELQ0)

DOT Name Centrosomal protein of 97 kDa (CEP97)
Synonyms Cep97; Leucine-rich repeat and IQ domain-containing protein 2
Gene Name CEP97
Related Disease
Nephropathy ( )
Neoplasm ( )
UniProt ID
CEP97_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF14580
Sequence
MAVARVDAALPPGEGSVVNWSGQGLQKLGPNLPCEADIHTLILDKNQIIKLENLEKCKRL
IQLSVANNRLVRMMGVAKLTLLRVLNLPHNSIGCVEGLKELVHLEWLNLAGNNLKAMEQI
NSCTALQHLDLSDNNISQIGDLSKLVSLKTLLLHGNIITSLRMAPAYLPRSLAILSLAEN
EIRDLNEISFLASLTELEQLSIMNNPCVMATPSIPGFDYRPYIVSWCLNLRVLDGYVISQ
KESLKAEWLYSQGKGRAYRPGQHIQLVQYLATVCPLTSTLGLQTAEDAKLEKILSKQRFH
QRQLMNQSQNEELSPLVPVETRASLIPEHSSPVQDCQISQESEPVIQVNSWVGINSNDDQ
LFAVKNNFPASVHTTRYSRNDLHLEDIQTDEDKLNCSLLSSESTFMPVASGLSPLSPTVE
LRLQGINLGLEDDGVADESVKGLESQVLDKEEEQPLWAANENSVQMMRSEINTEVNEKAG
LLPCPEPTIISAILKDDNHSLTFFPESTEQKQSDIKKPENTQPENKETISQATSEKLPMI
LTQRSVALGQDKVALQKLNDAATKLQACWRGFYARNYNPQAKDVRYEIRLRRMQEHIVCL
TDEIRRLRKERDEERIKKFVQEEAFRFLWNQVRSLQVWQQTVDQRLSSWHTDVPPISSTL
VPSKHPLFTQSQESSCDQNADWFIASDVAPQEKSLPEFPDSGFHSSLTEQVHSLQHSLDF
EKSSTEGSESSIMGNSIDTVRYGKESDLGDVSEEHGEWNKESSNNEQDNSLLEQYLTSVQ
QLEDADERTNFDTETRDSKLHIACFPVQLDTLSDGASVDESHGISPPLQGEISQTQENSK
LNAEVQGQQPECDSTFQLLHVGVTV
Function Acts as a key negative regulator of ciliogenesis in collaboration with CCP110 by capping the mother centriole thereby preventing cilia formation. Required for recruitment of CCP110 to the centrosome.
Reactome Pathway
RHOV GTPase cycle (R-HSA-9013424 )
Anchoring of the basal body to the plasma membrane (R-HSA-5620912 )

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Nephropathy DISXWP4P Definitive Biomarker [1]
Neoplasm DISZKGEW Strong Biomarker [2]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
8 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Centrosomal protein of 97 kDa (CEP97). [3]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Centrosomal protein of 97 kDa (CEP97). [4]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Centrosomal protein of 97 kDa (CEP97). [5]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Centrosomal protein of 97 kDa (CEP97). [6]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Centrosomal protein of 97 kDa (CEP97). [7]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of Centrosomal protein of 97 kDa (CEP97). [8]
Tocopherol DMBIJZ6 Phase 2 Tocopherol decreases the expression of Centrosomal protein of 97 kDa (CEP97). [9]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of Centrosomal protein of 97 kDa (CEP97). [10]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of Centrosomal protein of 97 kDa (CEP97). [11]
------------------------------------------------------------------------------------

References

1 Cep97 and CP110 suppress a cilia assembly program.Cell. 2007 Aug 24;130(4):678-90. doi: 10.1016/j.cell.2007.06.027.
2 Biophysical and Structural Characterization of the Centriolar Protein Cep104 Interaction Network.J Biol Chem. 2016 Aug 26;291(35):18496-504. doi: 10.1074/jbc.M116.739771. Epub 2016 Jul 8.
3 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
4 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
5 Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
6 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
7 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
8 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
9 Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
10 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
11 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.