Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OTXP1QC5)
| DOT Name | Interleukin-15 receptor subunit alpha (IL15RA) | ||||
|---|---|---|---|---|---|
| Synonyms | IL-15 receptor subunit alpha; IL-15R-alpha; IL-15RA; CD antigen CD215 | ||||
| Gene Name | IL15RA | ||||
| UniProt ID | |||||
| 3D Structure | |||||
| PDB ID | |||||
| Sequence |
MAPRRARGCRTLGLPALLLLLLLRPPATRGITCPPPMSVEHADIWVKSYSLYSRERYICN
SGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPE SLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTA KNWELTASASHQPPGVYPQGHSDTTVAISTSTVLLCGLSAVSLLACYLKSRQTPPLASVE MEAMEALPVTWGTSSRDEDLENCSHHL |
||||
| Function |
High-affinity receptor for interleukin-15. Can signal both in cis and trans where IL15R from one subset of cells presents IL15 to neighboring IL2RG-expressing cells. In neutrophils, binds and activates kinase SYK in response to IL15 stimulation. In neutrophils, required for IL15-induced phagocytosis in a SYK-dependent manner. Expression of different isoforms may alter or interfere with signal transduction ; [Isoform 5]: Does not bind IL15; [Isoform 6]: Does not bind IL15; [Isoform 7]: Does not bind IL15; [Isoform 8]: Does not bind IL15.
|
||||
| Tissue Specificity |
Expressed in neutrophils (at protein level) . Expressed in fetal brain with higher expression in the hippocampus and cerebellum than in cortex and thalamus . Higher levels of soluble sIL-15RA form in comparison with membrane-bound forms is present in all brain structures . Isoforms 1, 3, 4, 5, 6, 7, 8 and 9: Widely expressed .
|
||||
| KEGG Pathway | |||||
| Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DOT
| Molecular Interaction Atlas (MIA) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
6 Drug(s) Affected the Gene/Protein Processing of This DOT
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
2 Drug(s) Affected the Post-Translational Modifications of This DOT
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
