Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTXR1FWX)

• DOT Name: Cilia- and flagella-associated protein 36 (CFAP36)
• Synonyms: Coiled-coil domain-containing protein 104
• Gene Name: CFAP36
• Related Disease: Advanced cancer
• UniProt ID: CFA36_HUMAN
• Pfam ID: PF11527
• Sequence:
  MAAEEEDEVEWVVESIAGFLRGPDWSIPILDFVEQKCEVFDDEEESKLTYTEIHQEYKEL
  VEKLLEGYLKEIGINEDQFQEACTSPLAKTHTSQAILQPVLAAEDFTIFKAMMVQKNIEM
  QLQAIRIIQERNGVLPDCLTDGSDVVSDLEHEEMKILREVLRKSKEEYDQEEERKRKKQL
  SEAKTEEPTVHSSEAAIMNNSQGDGEHFAHPPSEVKMHFANQSIEPLGRKVERSETSSLP
  QKDLKIPGLEHASIEGPIANLSVLGTEELRQREHYLKQKRDKLMSMRKDMRTKQIQNMEQ
  KGKPTGEVEEMTEKPEMTAEEKQTLLKRRLLAEKLKEEVINK
• Function: May act as an effector for ARL3.
• Tissue Specificity: Expressed in several human tissues including brain, testis, heart, lung, pancreas and spleen (at protein level).

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Strong	Biomarker	[1]

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Cilia- and flagella-associated protein 36 (CFAP36).	[2]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Cilia- and flagella-associated protein 36 (CFAP36).	[3]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Cilia- and flagella-associated protein 36 (CFAP36).	[4]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Cilia- and flagella-associated protein 36 (CFAP36).	[5]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Cilia- and flagella-associated protein 36 (CFAP36).	[6]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Cilia- and flagella-associated protein 36 (CFAP36).	[7]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Cilia- and flagella-associated protein 36 (CFAP36).	[8]

References

• [1] Antibody to CCDC104 is associated with a paraneoplastic antibody to CDR2 (anti-Yo).Cancer Immunol Immunother. 2010 Feb;59(2):231-7. doi: 10.1007/s00262-009-0742-3.
• [2] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [3] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [4] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [5] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [6] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [7] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [8] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.