Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTY38VMO)

• DOT Name: Uncharacterized protein C19orf18 (C19ORF18)
• Gene Name: C19ORF18
• Related Disease:
  Drug dependence
  Substance abuse
  Substance dependence
• UniProt ID: CS018_HUMAN
• Pfam ID: PF17686
• Sequence:
  MDKVQSGFLILFLFLMECQLHLCLPYADGLHPTGNITGLPGSKRSQPPRNITKEPKVFFH
  KTQLPGIQGAASRSTAASPTNPMKFLRNKAIIRHRPALVKVILISSVAFSIALICGMAIS
  YMIYRLAQAEERQQLESLYKNLRIPLLGDEEEGSEDEGESTHLLPENENELEKFIHSVII
  SKRSKNIKKKLKEEQNSVTENKTKNASHNGKMEDL

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Drug dependence	DIS9IXRC	Strong	Biomarker	[1]
Substance abuse	DIS327VW	Strong	Biomarker	[1]
Substance dependence	DISDRAAR	Strong	Biomarker	[1]

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Uncharacterized protein C19orf18 (C19ORF18).	[2]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Uncharacterized protein C19orf18 (C19ORF18).	[3]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Uncharacterized protein C19orf18 (C19ORF18).	[4]

References

• [1] Genome wide association for addiction: replicated results and comparisons of two analytic approaches.PLoS One. 2010 Jan 21;5(1):e8832. doi: 10.1371/journal.pone.0008832.
• [2] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [3] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [4] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.