Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTY8H2OF)

• DOT Name: Vesicle transport protein GOT1A (GOLT1A)
• Synonyms: Golgi transport 1 homolog A; hGOT1b
• Gene Name: GOLT1A
• Related Disease:
  Breast cancer
  Breast carcinoma
  Advanced cancer
  Lung cancer
  Lung carcinoma
• UniProt ID: GOT1A_HUMAN
• Pfam ID: PF04178
• Sequence:
  MISITEWQKIGVGITGFGIFFILFGTLLYFDSVLLAFGNLLFLTGLSLIIGLRKTFWFFF
  QRHKLKGTSFLLGGVVIVLLRWPLLGMFLETYGFFSLFKGFFPVAFGFLGNVCNIPFLGA
  LFRRLQGTSSMV
• Function: May be involved in fusion of ER-derived transport vesicles with the Golgi complex.

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Breast cancer	DIS7DPX1	Definitive	Altered Expression	[1]
Breast carcinoma	DIS2UE88	Definitive	Altered Expression	[1]
Advanced cancer	DISAT1Z9	Limited	Altered Expression	[2]
Lung cancer	DISCM4YA	Limited	Altered Expression	[2]
Lung carcinoma	DISTR26C	Limited	Altered Expression	[2]

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Vesicle transport protein GOT1A (GOLT1A).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Vesicle transport protein GOT1A (GOLT1A).	[4]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Vesicle transport protein GOT1A (GOLT1A).	[5]
Estradiol	DMUNTE3	Approved	Estradiol affects the expression of Vesicle transport protein GOT1A (GOLT1A).	[6]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Vesicle transport protein GOT1A (GOLT1A).	[7]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Vesicle transport protein GOT1A (GOLT1A).	[8]
Azathioprine	DMMZSXQ	Approved	Azathioprine increases the expression of Vesicle transport protein GOT1A (GOLT1A).	[9]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the expression of Vesicle transport protein GOT1A (GOLT1A).	[11]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Vesicle transport protein GOT1A (GOLT1A).	[10]

References

• [1] miR-378a-3p modulates tamoxifen sensitivity in breast cancer MCF-7 cells through targeting GOLT1A.Sci Rep. 2015 Aug 10;5:13170. doi: 10.1038/srep13170.
• [2] Lidocaine inhibits the proliferation of lung cancer by regulating the expression of GOLT1A.Cell Prolif. 2017 Oct;50(5):e12364. doi: 10.1111/cpr.12364. Epub 2017 Jul 24.
• [3] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [4] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [5] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [6] Research resource: STR DNA profile and gene expression comparisons of human BG-1 cells and a BG-1/MCF-7 clonal variant. Mol Endocrinol. 2014 Dec;28(12):2072-81.
• [7] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [8] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [9] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [10] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [11] Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.