Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTZ29TSY)

• DOT Name: Uteroglobin (SCGB1A1)
• Synonyms: Club cell phospholipid-binding protein; CCPBP; Club cells 10 kDa secretory protein; CC10; Secretoglobin family 1A member 1; Urinary protein 1; UP-1; UP1; Urine protein 1
• Gene Name: SCGB1A1
• UniProt ID: UTER_HUMAN
• PDB ID: 7VF3; 7VG7
• Pfam ID: PF01099
• Sequence:
  MKLAVTLTLVTLALCCSSASAEICPSFQRVIETLLMDTPSSYEAAMELFSPDQDMREAGA
  QLKKLVDTLPQKPRESIIKLMEKIAQSSLCN
• Function: Binds phosphatidylcholine, phosphatidylinositol, polychlorinated biphenyls (PCB) and weakly progesterone, potent inhibitor of phospholipase A2.
• Tissue Specificity: Club cells (nonciliated cells of the surface epithelium of the pulmonary airways).

Molecular Interaction Atlas (MIA) of This DOT

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Uteroglobin (SCGB1A1).	[1]
Arsenic	DMTL2Y1	Approved	Arsenic decreases the expression of Uteroglobin (SCGB1A1).	[2]
Nitric Oxide	DM1RBYG	Approved	Nitric Oxide decreases the expression of Uteroglobin (SCGB1A1).	[3]
Aluminium	DM6ECN9	Approved	Aluminium decreases the expression of Uteroglobin (SCGB1A1).	[4]
Paraquat	DMR8O3X	Investigative	Paraquat increases the expression of Uteroglobin (SCGB1A1).	[5]
Deoxythymidine	DMR90HY	Investigative	Deoxythymidine affects the expression of Uteroglobin (SCGB1A1).	[6]

References

• [1] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [2] Arsenic alters transcriptional responses to Pseudomonas aeruginosa infection and decreases antimicrobial defense of human airway epithelial cells. Toxicol Appl Pharmacol. 2017 Sep 15;331:154-163.
• [3] Serum clara-cell protein and beta2-microglobulin as early markers of occupational exposure to nitric oxides. Inhal Toxicol. 2005 Feb;17(2):87-97. doi: 10.1080/08958370590899460.
• [4] Prognostic significance of low serum levels of Clara cell phospholipid-binding protein in occupational aluminium neurotoxicity. J Inorg Biochem. 2005 Sep;99(9):1904-11.
• [5] Pneumoproteins as markers of paraquat lung injury: a clinical case. J Forensic Leg Med. 2008 Jan;15(1):48-52. doi: 10.1016/j.jcfm.2006.09.003. Epub 2006 Dec 14.
• [6] Short-term changes in respiratory biomarkers after swimming in a chlorinated pool. Environ Health Perspect. 2010 Nov;118(11):1538-44. doi: 10.1289/ehp.1001961.