Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTZ7Y93J)

DOT Name	Rhomboid-related protein 3 (RHBDL3)
Synonyms	EC 3.4.21.105; Ventrhoid transmembrane protein
Gene Name	RHBDL3
Related Disease	Alzheimer disease ( )
UniProt ID	RHBL3_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
EC Number	3.4.21.105
Pfam ID	PF13499 ; PF01694
Sequence	MGEHPSPGPAVAACAEAERIEELEPEAEERLPAAPEDHWKVLFDQFDPGNTGYISTGKFR SLLESHSSKLDPHKREVLLALADSHADGQIGYQDFVSLMSNKRSNSFRQAILQGNRRLSS KALLEEKGLSLSQRLIRHVAYETLPREIDRKWYYDSYTCCPPPWFMITVTLLEVAFFLYN GVSLGQFVLQVTHPRYLKNSLVYHPQLRAQVWRYLTYIFMHAGIEHLGLNVVLQLLVGVP LEMVHGATRIGLVYVAGVVAGSLAVSVADMTAPVVGSSGGVYALVSAHLANIVMNWSGMK CQFKLLRMAVALICMSMEFGRAVWLRFHPSAYPPCPHPSFVAHLGGVAVGITLGVVVLRN YEQRLQDQSLWWIFVAMYTVFVLFAVFWNIFAYTLLDLKLPPPP
Function	May be involved in regulated intramembrane proteolysis and the subsequent release of functional polypeptides from their membrane anchors.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance		REF
Alzheimer disease	DISF8S70	Strong	Biomarker	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Rhomboid-related protein 3 (RHBDL3).	[2]
------------------------------------------------------------------------------------

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Rhomboid-related protein 3 (RHBDL3).	[3]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Rhomboid-related protein 3 (RHBDL3).	[4]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Rhomboid-related protein 3 (RHBDL3).	[5]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Rhomboid-related protein 3 (RHBDL3).	[6]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Rhomboid-related protein 3 (RHBDL3).	[7]
------------------------------------------------------------------------------------

References

1	Alternative Processing of the Amyloid Precursor Protein Family by Rhomboid Protease RHBDL4.J Biol Chem. 2016 Oct 14;291(42):21903-21912. doi: 10.1074/jbc.M116.753582. Epub 2016 Aug 25.
2	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3	Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
4	Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
5	A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
6	Inter- and intra-laboratory study to determine the reproducibility of toxicogenomics datasets. Toxicology. 2011 Nov 28;290(1):50-8.
7	Comparison of transcriptome expression alterations by chronic exposure to low-dose bisphenol A in different subtypes of breast cancer cells. Toxicol Appl Pharmacol. 2019 Dec 15;385:114814. doi: 10.1016/j.taap.2019.114814. Epub 2019 Nov 9.