Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTZAGY5R)

• DOT Name: Dual specificity protein phosphatase 21 (DUSP21)
• Synonyms: EC 3.1.3.16; EC 3.1.3.48; Low molecular weight dual specificity phosphatase 21; LMW-DSP21
• Gene Name: DUSP21
• Related Disease: Hepatocellular carcinoma
• UniProt ID: DUS21_HUMAN
• EC Number: 3.1.3.16; 3.1.3.48
• Pfam ID: PF00782
• Sequence:
  MTASASSFSSSQGVQQPSIYSFSQITRSLFLSNGVAANDKLLLSSNRITAIVNASVEVVN
  VFFEGIQYIKVPVTDARDSRLYDFFDPIADLIHTIDMRQGRTLLHCMAGVSRSASLCLAY
  LMKYHSMSLLDAHTWTKSRRPIIRPNNGFWEQLINYEFKLFNNNTVRMINSPVGNIPDIY
  EKDLRMMISM
• Function: Can dephosphorylate single and diphosphorylated synthetic MAPK peptides, with preference for the phosphotyrosine and diphosphorylated forms over phosphothreonine.
• Tissue Specificity: Expressed in testis.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[1]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Fulvestrant	DM0YZC6	Approved	Fulvestrant decreases the methylation of Dual specificity protein phosphatase 21 (DUSP21).	[2]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Dual specificity protein phosphatase 21 (DUSP21).	[3]

References

• [1] RNA interference against cancer/testis genes identifies dual specificity phosphatase 21 as a potential therapeutic target in human hepatocellular carcinoma.Hepatology. 2014 Feb;59(2):518-30. doi: 10.1002/hep.26665. Epub 2013 Dec 18.
• [2] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [3] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.