Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTZG4LQF)

DOT Name Ras-related protein Rab-39A (RAB39A)
Synonyms Rab-39
Gene Name RAB39A
Related Disease
Cervical cancer ( )
Cervical carcinoma ( )
Advanced cancer ( )
UniProt ID
RB39A_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00071
Sequence
METIWIYQFRLIVIGDSTVGKSCLLHRFTQGRFPGLRSPACDPTVGVDFFSRLLEIEPGK
RIKLQLWDTAGQERFRSITRSYYRNSVGGFLVFDITNRRSFEHVKDWLEEAKMYVQPFRI
VFLLVGHKCDLASQRQVTREEAEKLSADCGMKYIETSAKDATNVEESFTILTRDIYELIK
KGEICIQDGWEGVKSGFVPNTVHSSEEAVKPRKECFC
Function
Plays a role in the maturation and acidification of phagosomes that engulf pathogens, such as S.aureus and M.tuberculosis. Plays a role in vesicular trafficking. Plays a role in the fusion of phagosomes with lysosomes. Negatively regulates LPS-induced autophagosome formation in macrophages possibly by implicating PI3K. May be involved in multiple neurite formation.
Reactome Pathway
RAB geranylgeranylation (R-HSA-8873719 )
RAB GEFs exchange GTP for GDP on RABs (R-HSA-8876198 )
Intra-Golgi traffic (R-HSA-6811438 )

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Cervical cancer DISFSHPF Strong Biomarker [1]
Cervical carcinoma DIST4S00 Strong Biomarker [1]
Advanced cancer DISAT1Z9 Limited Altered Expression [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Ras-related protein Rab-39A (RAB39A). [2]
------------------------------------------------------------------------------------

References

1 Epigenetic silencing of Rab39a promotes epithelial to mesenchymal transition of cervical cancer through AKT signaling.Exp Cell Res. 2019 May 15;378(2):139-148. doi: 10.1016/j.yexcr.2019.02.025. Epub 2019 Feb 28.
2 Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.