Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTZQDYCZ)

DOT Name Small EDRK-rich factor 2 (SERF2)
Synonyms Gastric cancer-related protein VRG107; Protein 4F5-related; 4F5rel; h4F5rel
Gene Name SERF2
Related Disease
Neuroblastoma ( )
UniProt ID
SERF2_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF04419
Sequence
MTRGNQRELARQKNMKKQSDSVKGKRRDDGLSAAARKQRDSEIMQQKQKKANEKKEEPK
Function
Positive regulator of amyloid protein aggregation and proteotoxicity. Induces conformational changes in amyloid proteins, such as HTT, driving them into compact formations preceding the formation of aggregates.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Neuroblastoma DISVZBI4 Limited Biomarker [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
11 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Small EDRK-rich factor 2 (SERF2). [2]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Small EDRK-rich factor 2 (SERF2). [3]
Doxorubicin DMVP5YE Approved Doxorubicin increases the expression of Small EDRK-rich factor 2 (SERF2). [4]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Small EDRK-rich factor 2 (SERF2). [5]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Small EDRK-rich factor 2 (SERF2). [6]
Methotrexate DM2TEOL Approved Methotrexate decreases the expression of Small EDRK-rich factor 2 (SERF2). [7]
Fluorouracil DMUM7HZ Approved Fluorouracil decreases the expression of Small EDRK-rich factor 2 (SERF2). [8]
Mifepristone DMGZQEF Approved Mifepristone increases the expression of Small EDRK-rich factor 2 (SERF2). [9]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Small EDRK-rich factor 2 (SERF2). [10]
Bisphenol A DM2ZLD7 Investigative Bisphenol A affects the expression of Small EDRK-rich factor 2 (SERF2). [12]
chloropicrin DMSGBQA Investigative chloropicrin decreases the expression of Small EDRK-rich factor 2 (SERF2). [13]
------------------------------------------------------------------------------------
⏷ Show the Full List of 11 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Small EDRK-rich factor 2 (SERF2). [11]
------------------------------------------------------------------------------------

References

1 Structural insights into pro-aggregation effects of C. elegans CRAM-1 and its human ortholog SERF2.Sci Rep. 2018 Oct 5;8(1):14891. doi: 10.1038/s41598-018-33143-1.
2 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
3 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
4 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
5 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
6 Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
7 The contribution of methotrexate exposure and host factors on transcriptional variance in human liver. Toxicol Sci. 2007 Jun;97(2):582-94.
8 Pharmacogenomic identification of novel determinants of response to chemotherapy in colon cancer. Cancer Res. 2006 Mar 1;66(5):2765-77.
9 Mifepristone induced progesterone withdrawal reveals novel regulatory pathways in human endometrium. Mol Hum Reprod. 2007 Sep;13(9):641-54.
10 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
11 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
12 Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.
13 Molecular targets of chloropicrin in human airway epithelial cells. Toxicol In Vitro. 2017 Aug;42:247-254.