| DOT Name |
Fibroblast growth factor 23 (FGF23)
|
| Synonyms |
FGF-23; Phosphatonin; Tumor-derived hypophosphatemia-inducing factor |
| Gene Name |
FGF23
|
| Related Disease |
- Autosomal dominant hypophosphatemic rickets ( )
- Tumoral calcinosis, hyperphosphatemic, familial, 2 ( )
- Obsolete tumoral calcinosis, hyperphosphatemic, familial, 1 ( )
|
| UniProt ID |
|
| 3D Structure |
|
| PDB ID |
2P39 ; 5W21 ; 6S22 ; 7YSH ; 7YSU ; 7YSW |
| Pfam ID |
|
| Sequence |
MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGH
VDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTL
ENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRS
AEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTG
PEGCRPFAKFI
|
| Function |
Regulator of phosphate homeostasis. Inhibits renal tubular phosphate transport by reducing SLC34A1 levels. Up-regulates EGR1 expression in the presence of KL. Acts directly on the parathyroid to decrease PTH secretion. Regulator of vitamin-D metabolism. Negatively regulates osteoblast differentiation and matrix mineralization.
|
| Tissue Specificity |
Expressed in osteogenic cells particularly during phases of active bone remodeling. In adult trabecular bone, expressed in osteocytes and flattened bone-lining cells (inactive osteoblasts). |
| KEGG Pathway |
- MAPK sig.ling pathway (hsa04010 )
- Ras sig.ling pathway (hsa04014 )
- Rap1 sig.ling pathway (hsa04015 )
- Calcium sig.ling pathway (hsa04020 )
- PI3K-Akt sig.ling pathway (hsa04151 )
- Regulation of actin cytoskeleton (hsa04810 )
- Parathyroid hormone synthesis, secretion and action (hsa04928 )
- Pathways in cancer (hsa05200 )
- Melanoma (hsa05218 )
- Breast cancer (hsa05224 )
- Gastric cancer (hsa05226 )
|
| Reactome Pathway |
- (FGFR2 )
- (FGFR3 )
- (FGFR4 )
- PIP3 activates AKT signaling (R-HSA-1257604 )
- Signaling by activated point mutants of FGFR1 (R-HSA-1839122 )
- Signaling by activated point mutants of FGFR3 (R-HSA-1839130 )
- FGFR4 ligand binding and activation (R-HSA-190322 )
- FGFR3c ligand binding and activation (R-HSA-190372 )
- FGFR1c ligand binding and activation (R-HSA-190373 )
- FGFR1c and Klotho ligand binding and activation (R-HSA-190374 )
- FGFR2c ligand binding and activation (R-HSA-190375 )
- Activated point mutants of FGFR2 (R-HSA-2033519 )
- Constitutive Signaling by Aberrant PI3K in Cancer (R-HSA-2219530 )
- Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) (R-HSA-381426 )
- Phospholipase C-mediated cascade (R-HSA-5654219 )
- Phospholipase C-mediated cascade (R-HSA-5654221 )
- Phospholipase C-mediated cascade (R-HSA-5654227 )
- Phospholipase C-mediated cascade (R-HSA-5654228 )
- Downstream signaling of activated FGFR1 (R-HSA-5654687 )
- SHC-mediated cascade (R-HSA-5654688 )
- PI-3K cascade (R-HSA-5654689 )
- FRS-mediated FGFR1 signaling (R-HSA-5654693 )
- PI-3K cascade (R-HSA-5654695 )
- SHC-mediated cascade (R-HSA-5654699 )
- FRS-mediated FGFR2 signaling (R-HSA-5654700 )
- SHC-mediated cascade (R-HSA-5654704 )
- FRS-mediated FGFR3 signaling (R-HSA-5654706 )
- PI-3K cascade (R-HSA-5654710 )
- FRS-mediated FGFR4 signaling (R-HSA-5654712 )
- SHC-mediated cascade (R-HSA-5654719 )
- PI-3K cascade (R-HSA-5654720 )
- Negative regulation of FGFR1 signaling (R-HSA-5654726 )
- Negative regulation of FGFR2 signaling (R-HSA-5654727 )
- Negative regulation of FGFR3 signaling (R-HSA-5654732 )
- Negative regulation of FGFR4 signaling (R-HSA-5654733 )
- Signaling by FGFR2 in disease (R-HSA-5655253 )
- Signaling by FGFR1 in disease (R-HSA-5655302 )
- Signaling by FGFR3 in disease (R-HSA-5655332 )
- FGFRL1 modulation of FGFR1 signaling (R-HSA-5658623 )
- RAF/MAP kinase cascade (R-HSA-5673001 )
- PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling (R-HSA-6811558 )
- Post-translational protein phosphorylation (R-HSA-8957275 )
- PI3K Cascade (R-HSA-109704 )
|
|
|
|
|
|
|
