Details of the Drug
General Information of Drug (ID: DM3R8YL)
Drug Name |
Erythropoietin
|
||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Synonyms | NuPIAO; Erythropoietin (second generation, anemia/blood cell mobilization); Erythropoietin (second generation, anemia/blood cell mobilization), 3SBio | ||||||||||||||||||||||||||||||
Indication |
|
||||||||||||||||||||||||||||||
Affected Organisms |
Humans and other mammals
|
||||||||||||||||||||||||||||||
ATC Code | |||||||||||||||||||||||||||||||
Sequence |
APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQA
VEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAIS PPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR |
||||||||||||||||||||||||||||||
Structure |
![]() |
||||||||||||||||||||||||||||||
3D MOL is unavailable | 2D MOL | ||||||||||||||||||||||||||||||
#Ro5 Violations (Lipinski): 0 |
Molecular Weight | 461 | |||||||||||||||||||||||||||||
Logarithm of the Partition Coefficient | Not Available | ||||||||||||||||||||||||||||||
Rotatable Bond Count | 8 | ||||||||||||||||||||||||||||||
Hydrogen Bond Donor Count | 1 | ||||||||||||||||||||||||||||||
Hydrogen Bond Acceptor Count | 6 | ||||||||||||||||||||||||||||||
ADMET Property |
|
||||||||||||||||||||||||||||||
Chemical Identifiers |
|
||||||||||||||||||||||||||||||
Cross-matching ID | |||||||||||||||||||||||||||||||
Repurposed Drugs (RPD) | Click to Jump to the Detailed RPD Information of This Drug | ||||||||||||||||||||||||||||||
Molecular Interaction Atlas of This Drug
![]() Drug Therapeutic Target (DTT) |
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
![]() Drug Off-Target (DOT) |
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecular Expression Atlas of This Drug
The Studied Disease | Periventricular leukomalacia | |||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
ICD Disease Classification | ||||||||||||||||||||||||
|
||||||||||||||||||||||||
Molecular Expression Atlas (MEA) | ||||||||||||||||||||||||
Drug-Drug Interaction (DDI) Information of This Drug
Coadministration of a Drug Treating the Disease Different from Erythropoietin (Comorbidity)
|
References