Details of the Drug
General Information of Drug (ID: DMMJTYW)
| Drug Name |
Darbepoetin alfa
|
||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Synonyms | Aranesp (TN) | ||||||||||||||||||||||||||||||||||
| Indication |
|
||||||||||||||||||||||||||||||||||
| Therapeutic Class |
Antianemic Agents
|
||||||||||||||||||||||||||||||||||
| Affected Organisms |
Humans and other mammals
|
||||||||||||||||||||||||||||||||||
| ATC Code | |||||||||||||||||||||||||||||||||||
| Sequence |
APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQA
VEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAIS PPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR |
||||||||||||||||||||||||||||||||||
| Cross-matching ID | |||||||||||||||||||||||||||||||||||
| Repurposed Drugs (RPD) | Click to Jump to the Detailed RPD Information of This Drug | ||||||||||||||||||||||||||||||||||
Molecular Interaction Atlas of This Drug
![]() Drug Therapeutic Target (DTT) |
|
||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Molecular Interaction Atlas (MIA) | |||||||||||||||||||||||||||
Molecular Expression Atlas of This Drug
| The Studied Disease | Anemia | |||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| ICD Disease Classification | 3A00-3A9Z | |||||||||||||||||||||||
|
||||||||||||||||||||||||
| Molecular Expression Atlas (MEA) | ||||||||||||||||||||||||
Drug-Drug Interaction (DDI) Information of This Drug
|
Coadministration of a Drug Treating the Disease Different from Darbepoetin alfa (Comorbidity)
|
|||||||||||||||||||||||||||||
References

