Details of the Drug
General Information of Drug (ID: DMUH012)
| Drug Name |
PMID26911565-peptide-P9
|
||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Synonyms | PMID26911565-P9 | ||||||||||||||||||||||||||
| Indication |
|
||||||||||||||||||||||||||
| Therapeutic Class |
Antiviral Agents
|
||||||||||||||||||||||||||
| Drug Type |
Protein/peptide drug
|
||||||||||||||||||||||||||
| Sequence |
NGAICWGPCPTAFRQIGNCGHFKVRCCKIR
|
||||||||||||||||||||||||||
| Cross-matching ID | |||||||||||||||||||||||||||
| Repurposed Drugs (RPD) | Click to Jump to the Detailed RPD Information of This Drug | ||||||||||||||||||||||||||
Molecular Interaction Atlas of This Drug
![]() Drug Therapeutic Target (DTT) |
|
|||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||||

