Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT0C8BY)

• DTT Name: Plasma retinol-binding protein (RBP4)
• Synonyms: Retinol-binding protein 4; RBP4; RBP; Plasma retinol-binding protein(1-176); PRBP
• Gene Name: RBP4
• DTT Type: Patented-recorded target; [1]
• BioChemical Class: Calycin family
• UniProt ID: RET4_HUMAN
• TTD ID: T55703
• Sequence:
  MKWVWALLLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIV
  AEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGND
  DHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLA
  RQYRLIVHNGYCDGRSERNLL
• Function: Delivers retinol from the liver stores to the peripheral tissues. In plasma, the RBP-retinol complex interacts with transthyretin, this prevents its loss by filtration through the kidney glomeruli.
• Reactome Pathway:
  The canonical retinoid cycle in rods (twilight vision) (R-HSA-2453902)
  Retinoid metabolism disease events (R-HSA-6809583)
  Retinoid metabolism and transport (R-HSA-975634)
  Retinoid cycle disease events (R-HSA-2453864)
• BioCyc Pathway: MetaCyc:ENSG00000138207-MON

Molecular Interaction Atlas (MIA) of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Tinlarebant	DM6JYUO	Stargardt disease	9B70	Phase 3	[2]

11 Patented Agent(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
A1-10436	DM9ESPR	N. A.	N. A.	Patented	[3]
A1-10438	DMJD1S6	N. A.	N. A.	Patented	[3]
US8586571, 12	DMKLJ6O	N. A.	N. A.	Patented	[4]
US8586571, 36	DMX3A0O	N. A.	N. A.	Patented	[4]
US8586571, 6	DM1N74R	N. A.	N. A.	Patented	[4]
US8853215, 3	DMX8NLB	N. A.	N. A.	Patented	[3]
US9434727, 120	DMIT0H3	N. A.	N. A.	Patented	[5]
US9434727, 153	DMC812I	N. A.	N. A.	Patented	[5]
US9434727, 40	DMLPWK3	N. A.	N. A.	Patented	[6]
US9434727, 63	DM9HQXC	N. A.	N. A.	Patented	[5]
US9434727, 93	DMCJG8Z	N. A.	N. A.	Patented	[7]

References

• [1] Design, Synthesis, and Preclinical Efficacy of Novel Nonretinoid Antagonists of Retinol-Binding Protein 4 in the Mouse Model of Hepatic Steatosis. J Med Chem. 2019 Jun 13;62(11):5470-5500.
• [2] Retinol binding protein 4 antagonists and protein synthesis inhibitors: Potential for therapeutic development. Eur J Med Chem. 2021 Dec 15;226:113856.
• [3] Derivatives of N-acyl-N-phenylpiperazine useful (inter alia) for the prophylaxis or treatment of diabetes. US8853215.
• [4] Heterocyclic compound. US8586571.
• [5] Substituted 4-phenylpiperidines, their preparation and use. US9434727.
• [6] Substituted 4-phenylpiperidines, their preparation and use. US9777010.
• [7] Substituted 4-phenylpiperidines, their preparation and use. US10072016.