Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT0R12H)
| DTT Name | Neuron-specific vesicular protein calcyon (CALY) | ||||
|---|---|---|---|---|---|
| Synonyms | Neuronspecific vesicular protein calcyon; CALY | ||||
| Gene Name | CALY | ||||
| DTT Type |
Discontinued target
|
[1] | |||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MVKLGCSFSGKPGKDPGDQDGAAMDSVPLISPLDISQLQPPLPDQVVIKTQTEYQLSSPD
QQNFPDLEGQRLNCSHPEEGRRLPTARMIAFAMALLGCVLIMYKAIWYDQFTCPDGFLLR HKICTPLTLEMYYTEMDPERHRSILAAIGAYPLSRKHGTETPAAWGDGYRAAKEERKGPT QAGAAAAATEPPGKPSAKAEKEAARKAAGSAAPPPAQ |
||||
| Function | Interacts with clathrin light chain A and stimulates clathrin self-assembly and clathrin-mediated endocytosis. | ||||
| KEGG Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
1 Discontinued Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||
|
1 Investigative Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||
