Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT1YWO5)

DTT Name	Glucagon-like peptide 2 receptor (GLP2R)
Synonyms	GLP2R; GLP2 receptor
Gene Name	GLP2R
DTT Type	Successful target	[1]
BioChemical Class	GPCR secretin
UniProt ID	GLP2R_HUMAN
TTD ID	T34843
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MKLGSSRAGPGRGSAGLLPGVHELPMGIPAPWGTSPLSFHRKCSLWAPGRPFLTLVLLVS IKQVTGSLLEETTRKWAQYKQACLRDLLKEPSGIFCNGTFDQYVCWPHSSPGNVSVPCPS YLPWWSEESSGRAYRHCLAQGTWQTIENATDIWQDDSECSENHSFKQNVDRYALLSTLQL MYTVGYSFSLISLFLALTLLLFLRKLHCTRNYIHMNLFASFILRTLAVLVKDVVFYNSYS KRPDNENGWMSYLSEMSTSCRSVQVLLHYFVGANYLWLLVEGLYLHTLLEPTVLPERRLW PRYLLLGWAFPVLFVVPWGFARAHLENTGCWTTNGNKKIWWIIRGPMMLCVTVNFFIFLK ILKLLISKLKAHQMCFRDYKYRLAKSTLVLIPLLGVHEILFSFITDDQVEGFAKLIRLFI QLTLSSFHGFLVALQYGFANGEVKAELRKYWVRFLLARHSGCRACVLGKDFRFLGKCPKK LSEGDGAEKLRKLQPSLNSGRLLHLAMRGLGELGAQPQQDHARWPRGSSLSECSEGDVTM ANTMEEILEESEI
Function	This is a receptor for glucagon-like peptide 2. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
KEGG Pathway	Neuroactive ligand-receptor interaction (hsa04080 )
Reactome Pathway	Glucagon-type ligand receptors (R-HSA-420092 ) G alpha (s) signalling events (R-HSA-418555 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DTT

1 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Teduglutide	DMYOAKS	Short bowel syndrome	KB89.1	Approved	[1]
------------------------------------------------------------------------------------

3 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Elsiglutide	DMB7CPG	Diarrhea	ME05.1	Phase 2	[2]
SAN-134	DMWU71N	Osteoporosis	FB83.0	Phase 1	[3]
ZP-1848	DMGTL8Z	Inflammatory bowel disease	DD72	Phase 1	[4]
------------------------------------------------------------------------------------

2 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
AMX-256	DMGHXQE	Short bowel syndrome	KB89.1	Investigative	[5]
FE-203799	DMBX81R	Gastrointestinal disease	DE2Z	Investigative	[5]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTT

Molecular Expression Atlas (MEA)

Jump to Detail Molecular Expression Atlas of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Osteoporosis	FA20	Bone marrow	6.12E-01	0.06	0.3
------------------------------------------------------------------------------------

References

1	Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
2	Poster Abstracts. Volume 10, Issue Supplement S8, pages 126-209, December 2014.
3	Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800020865)
4	US patent application no. 8,580,918, Peptidic glp-2 agonists.
5	URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 250).