Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT2B6EV)

• DTT Name: Histamine N-methyltransferase (HNMT)
• Synonyms: Histamine-N-methyltransferase; HNMT; HMT
• Gene Name: HNMT
• DTT Type: Successful target; [1]
• BioChemical Class: Methyltransferase
• UniProt ID: HNMT_HUMAN
• TTD ID: T17448
• EC Number: EC 2.1.1.8
• Sequence:
  MASSMRSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKLPGIIGRIGDTKSEIKILSIG
  GGAGEIDLQILSKVQAQYPGVCINNEVVEPSAEQIAKYKELVAKTSNLENVKFAWHKETS
  SEYQSRMLEKKELQKWDFIHMIQMLYYVKDIPATLKFFHSLLGTNAKMLIIVVSGSSGWD
  KLWKKYGSRFPQDDLCQYITSDDLTQMLDNLGLKYECYDLLSTMDISDCFIDGNENGDLL
  WDFLTETCNFNATAPPDLRAELGKDLQEPEFSAKKEGKVLFNNTLSFIVIEA
• Function: Inactivates histamine by N-methylation. Plays an important role in degrading histamine and in regulating the airway response to histamine.
• KEGG Pathway: Histidine metabolism (hsa00340)
• Reactome Pathway:
  Histidine catabolism (R-HSA-70921)
  Metabolism of ingested SeMet, Sec, MeSec into H2Se (R-HSA-2408508)
• BioCyc Pathway: MetaCyc:HS07674-MON

Molecular Interaction Atlas (MIA) of This DTT

2 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Amodiaquine	DME4RA8	Malaria	1F40-1F45	Approved	[1]
Diphenhydramine	DMKQTBA	Hyperemesis gravidarum		Approved	[2]

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Metoprine	DM5GQD7	Advanced cancer	2A00-2F9Z	Phase 2	[2]

2 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
(L-)-S-adenosyl-L-homocysteine	DMDUN83	Discovery agent	N.A.	Investigative	[3]
4-(DIMETHYLAMINO)BUTYL IMIDOTHIOCARBAMATE	DM68S9F	Discovery agent	N.A.	Investigative	[2]

The Drug-Metabolizing Enzyme (DME) Role of This DTT

• DTT DME Name: Histamine N-methyltransferase (HNMT) DME Info
• Gene Name: HNMT

1 Approved Drug(s) Metabolized by This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Ergotidine	DM78IME	Osteoarthritis	FA00-FA05	Approved	[4]

References

• [1] Effect of amodiaquine, a histamine N-methyltransferase inhibitor, on, Propionibacterium acnes and lipopolysaccharide-induced hepatitis in mice. Eur J Pharmacol. 2007 Mar 8;558(1-3):179-84.
• [2] The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.
• [3] How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
• [4] Histamine pharmacogenomics. Pharmacogenomics. 2009 May;10(5):867-83.