Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT3Z102)
| DTT Name | Ebola virus VP35 messenger RNA (EV VP35 mRNA) | ||||
|---|---|---|---|---|---|
| Synonyms | VP35 (mRNA); Polymerase cofactor VP35 (mRNA) | ||||
| Gene Name | EV VP35 mRNA | ||||
| DTT Type |
Clinical trial target
|
[1] | |||
| BioChemical Class |
mRNA target
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| Sequence |
MQQDRTYRHHGPEVSGWFSEQLMTGKIPLTEVFVDVENKPSPAPITIISKNPKTTRKSDK
QVQTDDASSLLTEEVKAAINSVISAVRRQTNAIESLEGRVTTLEASLKPVQDMAKTISSL NRSCAEMVAKYDLLVMTTGRATATAAATEAYWNEHGQAPPGPSLYEDDAIKAKLKDPNGK VPESVKQAYINLDSTSALNEENFGRPYISAKDLKEIIYDHLPGFGTAFHQLVQVICKIGK DNNILDIIHAEFQASLAEGDSPQCALIQITKRIPAFQDASPPIVHIKSRGDIPKACQKSL RPVPPSPKIDRGWVCIFQFQDGKALGLKI |
||||
| Function |
Prevents establishment of cellular antiviral state by blocking virus-induced phosphorylation and activation of interferon regulatory factor 3 (IRF3), a transcription factor critical for the induction of interferons alpha and beta. This blockage is produced through the interaction with and inhibition host IKBKE and TBK1 producing a strong inhibition of the phosphorylation and activation of IRF3. Also inhibits the antiviral effect mediated by the interferon-induced, double-stranded RNA-activated protein kinase EIF2AK2/PKR. Acts as a polymerase cofactor in the RNA polymerase transcription and replication complex.
|
||||
Molecular Interaction Atlas (MIA) of This DTT
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
2 Clinical Trial Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||||||||