Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT4NXYM)

• DTT Name: Human immunodeficiency virus Negative factor (HIV nef)
• Synonyms: nef; Nef protein; F-protein; 3'ORF; 27 kDa protein
• Gene Name: HIV nef
• DTT Type: Clinical trial target; [1]
• BioChemical Class: Lentivirus primate group Nef
• UniProt ID: NEF_HV1A2
• TTD ID: T83793
• Sequence:
  MGGKWSKRSMGGWSAIRERMRRAEPRAEPAADGVGAVSRDLEKHGAITSSNTAATNADCA
  WLEAQEEEEVGFPVRPQVPLRPMTYKAALDISHFLKEKGGLEGLIWSQRRQEILDLWIYH
  TQGYFPDWQNYTPGPGIRYPLTFGWCFKLVPVEPEKVEEANEGENNSLLHPMSLHGMEDA
  EKEVLVWRFDSKLAFHHMARELHPEYYKDC
• Function: Extracellular Nef protein targets CD4(+) T-lymphocytes for apoptosis by interacting with CXCR4 surface receptors.

Molecular Interaction Atlas (MIA) of This DTT

4 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
F4co vaccine	DM6UQNW	Human immunodeficiency virus infection	1C62	Phase 2	[1]
LIPO-5	DMWY0V1	Human immunodeficiency virus infection	1C62	Phase 2	[2]
Ad35-GRIN	DM4L28K	Human immunodeficiency virus infection	1C62	Phase 1/2	[3]
Ad35-GRIN/ENV	DMG82ZA	Human immunodeficiency virus infection	1C62	Phase 1	[3]

1 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
GSK-732461	DMJ0ZB6	Human immunodeficiency virus infection	1C62	Discontinued in Phase 2	[4]

1 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
MYRISTIC ACID	DMYX0BL	Discovery agent	N.A.	Investigative	[5]

References

• [1] EP patent application no. 2621528, Vaccine.
• [2] HIV specific responses induced in nonhuman primates with ANRS HIV-Lipo-5 vaccine combined with rMVA-HIV prime or boost immunizations. Vaccine. 2015 May 11;33(20):2354-9.
• [3] A phase I double blind, placebo-controlled, randomized study of a multigenic HIV-1 adenovirus subtype 35 vector vaccine in healthy uninfected adults. PLoS One. 2012;7(8):e41936.
• [4] Preventive technologies, research toward a cure, and immune-based and gene therapies. HIV Treatment Bulletin. 30 June 2013.
• [5] The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.