Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT4TZ8J)

• DTT Name: Interferon-beta (IFNB1)
• Synonyms: Interferon beta; IFNbeta; IFNB; IFN-beta; IFB; Fibroblast interferon
• Gene Name: IFNB1
• DTT Type: Successful target; [1]
• BioChemical Class: Cytokine: interferon
• UniProt ID: IFNB_HUMAN
• TTD ID: T02808
• Sequence:
  MTNKCLLQIALLLCFSTTALSMSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFD
  IPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLK
  TVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINR
  LTGYLRN
• Function: Has antiviral, antibacterial and anticancer activities.
• KEGG Pathway:
  Cytokine-cytokine receptor interaction (hsa04060)
  PI3K-Akt signaling pathway (hsa04151)
  Osteoclast differentiation (hsa04380)
  Toll-like receptor signaling pathway (hsa04620)
  RIG-I-like receptor signaling pathway (hsa04622)
  Cytosolic DNA-sensing pathway (hsa04623)
  Jak-STAT signaling pathway (hsa04630)
  Natural killer cell mediated cytotoxicity (hsa04650)
  Chagas disease (American trypanosomiasis) (hsa05142)
  Tuberculosis (hsa05152)
  Hepatitis C (hsa05160)
  Hepatitis B (hsa05161)
  Measles (hsa05162)
  Influenza A (hsa05164)
  Herpes simplex infection (hsa05168)
• Reactome Pathway:
  Interferon alpha/beta signaling (R-HSA-909733)
  Regulation of IFNA signaling (R-HSA-912694)
  TRAF3-dependent IRF activation pathway (R-HSA-918233)
  TRAF6 mediated IRF7 activation (R-HSA-933541)
  Factors involved in megakaryocyte development and platelet production (R-HSA-983231)
  Oxidative Stress Induced Senescence (R-HSA-2559580)

Molecular Interaction Atlas (MIA) of This DTT

3 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Interferon beta-1a	DM1A6RV	Multiple sclerosis	8A40	Approved	[2]
PEGylated IFN beta 1-a	DMRH0D5	Type-2 diabetes	5A11	Approved	[1]
PLEGRIDY	DMAKXW9	Multiple sclerosis	8A40	Approved	[3]

8 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Biferonex	DM57B9J	Multiple sclerosis	8A40	Phase 3	[4]
FP-1201	DM823WQ	Acute lung injury	NB32.3	Phase 3	[5]
NU-100	DMA16IL	Multiple sclerosis	8A40	Phase 3	[6]
AZ-01, PEGylated interferon-beta	DMHFUJT	Multiple sclerosis	8A40	Phase 2	[6]
Interferon beta 1a	DMQSA7H	Discovery agent	N.A.	Phase 2	[7]
PF-06823859	DM8C1H4	Dermatomycosis	EA60	Phase 2	[8]
ARX-424	DM4CZ2Y	Multiple sclerosis	8A40	Phase 1	[6]
Gene therapy, IFN-b	DMJP83V	Glioblastoma multiforme	2A00.0	Phase 1	[9]

1 Preclinical Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
TV-1390	DMB7WEY	Multiple sclerosis	8A40	Preclinical	[10]

1 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Maxy-10	DM31WQC	Autoimmune diabetes	5A10	Terminated	[11]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Type 2 diabetes	5A11	Liver tissue	1.91E-01	-0.07	-0.25
Glioma	2C82	Brainstem tissue	5.84E-01	-0.07	-0.63
Glioma	2C82	White matter	3.78E-01	-0.57	-0.55

References

• [1] Pegylated interferon beta-1a for relapsing-remitting multiple sclerosis (ADVANCE): a randomised, phase 3, double-blind study. Lancet Neurol. 2014 Jul;13(7):657-65.
• [2] Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
• [3] 2014 FDA drug approvals. Nat Rev Drug Discov. 2015 Feb;14(2):77-81.
• [4] Improving compliance with interferon-beta therapy in patients with multiple sclerosis. CNS Drugs. 2009;23(6):453-62.
• [5] The effect of intravenous interferon-beta-1a (FP-1201) on lung CD73 expression and on acute respiratory distress syndrome mortality: an open-label study.Lancet Respir Med. 2014 Feb;2(2):98-107.
• [6] PEGylated interferon beta-1a in the treatment of multiple sclerosis - an update. Biologics. 2013; 7: 131-138.
• [7] Interpreting expression profiles of cancers by genome-wide survey of breadth of expression in normal tissues. Genomics 2005 Aug;86(2):127-41.
• [8] Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
• [9] Interferon-beta gene therapy for cancer: basic research to clinical application. Cancer Sci. 2004 Nov;95(11):858-65.
• [10] Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800032947)
• [11] US patent application no. 8,669,257, Phenazine derivatives and uses thereof as potassium channel modulators.