Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT4YANI)
| DTT Name | Annexin A2 (ANXA2) | ||||
|---|---|---|---|---|---|
| Synonyms | p36; Protein I; Placental anticoagulant protein IV; PAP-IV; Lipocortin II; LPC2D; Chromobindin-8; Calpactin-1 heavy chain; Calpactin I heavy chain; CAL1H; Annexin-2; Annexin II; ANX2L4; ANX2 | ||||
| Gene Name | ANXA2 | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| BioChemical Class |
Annexin protein
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNIL
TNRSNAQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKG LGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRA EDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWISIMTERSVPHLQKVFDRYKSYSPYDM LESIRKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGKGTRDKVLIRIMVSRSEVDM LKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD |
||||
| Function |
It binds two calcium ions with high affinity. May be involved in heat-stress response. Inhibits PCSK9-enhanced LDLR degradation, probably reduces PCSK9 protein levels via a translational mechanism but also competes with LDLR for binding with PCSK9. Calcium-regulated membrane-binding protein whose affinity for calcium is greatly enhanced by anionic phospholipids.
|
||||
| KEGG Pathway | |||||
| Reactome Pathway | |||||
