Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT5B8AX)

• DTT Name: Mycobacterium Thymidine monophosphate kinase (MycB tmk)
• Synonyms: tmk; Thymidylic kinase; Thymidylic acid kinase; Thymidylate monophosphate kinase; Thymidylate kinase; Thymidine 5'-monophosphate kinase; TMPK; Deoxythymidine 5'-monophosphate kinase; DTMPkinase
• Gene Name: MycB tmk
• DTT Type: Literature-reported target; [1]
• BioChemical Class: Kinase
• UniProt ID: KTHY_MYCTU
• TTD ID: T94400
• EC Number: EC 2.7.4.9
• Sequence:
  MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLA
  SSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWV
  QRIEFARLGLPKPDWQVLLAVSAELAGERSRGRAQRDPGRARDNYERDAELQQRTGAVYA
  ELAAQGWGGRWLVVGADVDPGRLAATLAPPDVPS
• Function: Catalyzes the reversible phosphorylation of deoxythymidine monophosphate (dTMP) to deoxythymidine diphosphate (dTDP), using ATP as its preferred phosphoryl donor. Situated at the junction of both de novo and salvage pathways of deoxythymidine triphosphate (dTTP) synthesis, is essential for DNA synthesis and cellular growth. Has a broad specificity for nucleoside triphosphates, being highly active withATP or dATP as phosphate donors, and less active with ITP, GTP, CTP and UTP.
• KEGG Pathway:
  Pyrimidine metabolism (mtu00240)
  Metabolic pathways (mtu01100)
• BioCyc Pathway: MetaCyc:G185E-7521-MON

Molecular Interaction Atlas (MIA) of This DTT

14 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
2',3'-Dideoxythymidine-5'-Monophosphate	DMEQXUD	Discovery agent	N.A.	Investigative	[2]
2'-deoxythymidine triphosphate	DM9OEJT	Discovery agent	N.A.	Investigative	[2]
3'-Azido-3'-Deoxythymidine-5'-Monophosphate	DMU08MN	Discovery agent	N.A.	Investigative	[2]
5'-amino-5'-deoxy-alpha-D-thymidine	DMBF42W	Discovery agent	N.A.	Investigative	[3]
5'-deoxythymidine	DMR48NG	Discovery agent	N.A.	Investigative	[1]
5-Hydroxymethyluridine-2'-Deoxy-5'-Monophosphate	DMWVCJ1	Discovery agent	N.A.	Investigative	[2]
Acetate Ion	DMD08RH	Discovery agent	N.A.	Investigative	[2]
AMP-PNP	DMTOK1D	Discovery agent	N.A.	Investigative	[4]
BROMODEOXYURIDINE	DM0D7LA	Discovery agent	N.A.	Investigative	[5]
CHLORODEOXYURIDINE	DMQT3WJ	Discovery agent	N.A.	Investigative	[5]
Deoxythymidine	DMR90HY	Discovery agent	N.A.	Investigative	[2]
Diphosphate	DMHY30B	Discovery agent	N.A.	Investigative	[2]
P1-(5'-Adenosyl)P5-(5'-Thymidyl)Pentaphosphate	DMM4VWD	Discovery agent	N.A.	Investigative	[6]
Thymidine-5'-Phosphate	DMKM6NQ	Discovery agent	N.A.	Investigative	[2]

References

• [1] Thymidylate kinase as target enzyme for 5'-deoxythymidine and various 5'-deoxy-5'-halogeno pyrimidine nucleosides. Acta Biol Med Ger. 1969;23(6):Suppl:K 19+.
• [2] How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
• [3] Rational design of 5'-thiourea-substituted alpha-thymidine analogues as thymidine monophosphate kinase inhibitors capable of inhibiting mycobacteri... J Med Chem. 2007 Nov 1;50(22):5281-92.
• [4] The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.
• [5] Substituted benzyl-pyrimidines targeting thymidine monophosphate kinase of Mycobacterium tuberculosis: synthesis and in vitro anti-mycobacterial ac... Bioorg Med Chem. 2008 Jun 1;16(11):6075-85.
• [6] DrugBank 3.0: a comprehensive resource for 'omics' research on drugs. Nucleic Acids Res. 2011 Jan;39(Database issue):D1035-41.