Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT95ICL)
| DTT Name | Mannose-6-phosphate receptor (M6PR) | ||||
|---|---|---|---|---|---|
| Synonyms | MPRD; MPR46; MPR 46; Cation-dependent mannose-6-phosphate receptor; CDMan-6-P receptor; CD-MPR; CD Man-6-P receptor; 46kDa mannose 6-phosphate receptor; 46 kDa mannose 6-phosphate receptor | ||||
| Gene Name | M6PR | ||||
| DTT Type |
Successful target
|
[1] | |||
| BioChemical Class |
Mannose 6-phosphate receptor
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MFPFYSCWRTGLLLLLLAVAVRESWQTEEKTCDLVGEKGKESEKELALVKRLKPLFNKSF
ESTVGQGSDTYIYIFRVCREAGNHTSGAGLVQINKSNGKETVVGRLNETHIFNGSNWIML IYKGGDEYDNHCGKEQRRAVVMISCNRHTLADNFNPVSEERGKVQDCFYLFEMDSSLACS PEISHLSVGSILLVTFASLVAVYVVGGFLYQRLVVGAKGMEQFPHLAFWQDLGNLVADGC DFVCRSKPRNVPAAYRGVGDDQLGEESEERDDHLLPM |
||||
| Function |
Lysosomal enzymes bearing phosphomannosyl residues bind specifically to mannose-6-phosphate receptors in the Golgi apparatus and the resulting receptor-ligand complex is transported to an acidic prelyosomal compartment where the low pH mediates the dissociation of the complex. Transport of phosphorylated lysosomal enzymes from the Golgi complex and the cell surface to lysosomes.
|
||||
| KEGG Pathway | |||||
| Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
1 Approved Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||||||||
|
2 Investigative Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||||||||
