Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT9NXW4)

DTT Name Sigma intracellular receptor 2 (TMEM97)
Synonyms Transmembrane protein 97; Sigma2 receptor; Sigma-2 receptor; Meningioma-associated protein 30; MAC30
Gene Name TMEM97
DTT Type
Clinical trial target
 [1]
BioChemical Class
TMEM97/sigma-2 receptor
UniProt ID
SGMR2_HUMAN
TTD ID
T45674
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MGAPATRRCVEWLLGLYFLSHIPITLFMDLQAVLPRELYPVEFRNLLKWYAKEFKDPLLQ
EPPAWFKSFLFCELVFQLPFFPIATYAFLKGSCKWIRTPAIIYSVHTMTTLIPILSTFLF
EDFSKASGFKGQRPETLHERLTLVSVYAPYLLIPFILLIFMLRSPYYKYEEKRKKK
Function
Intracellular orphan receptor that binds numerous drugs and which is highly expressed in various proliferating cancer cells. Corresponds to the sigma-2 receptor, which is thought to play important role in regulating cell survival, morphology and differentiation. Under investigation for its potential diagnostic and therapeutic uses. May play a role as a regulator of cellular cholesterol homeostasis. May function as sterol isomerase. May alter the activity of some cytochrome P450 proteins.

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTT
2 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
MIN-101 DMCJY35 Schizophrenia 6A20 Phase 3 [1]
CT1812 DMBRKZ7 Alzheimer disease 8A20 Phase 2 [2]
------------------------------------------------------------------------------------
52 Patented Agent(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Aryl azepine derivative 1 DMA9B0V N. A. N. A. Patented [3]
Aryl azepine derivative 2 DMI4XBC N. A. N. A. Patented [3]
Benzamide derivative 1 DMDOCTB N. A. N. A. Patented [4]
Benzamide derivative 10 DM9PKU2 N. A. N. A. Patented [3]
Benzamide derivative 11 DM4V3Y5 N. A. N. A. Patented [3]
Benzamide derivative 2 DM0UWNY N. A. N. A. Patented [4]
Benzamide derivative 3 DMFY78L N. A. N. A. Patented [4]
Benzamide derivative 4 DMNKYL9 N. A. N. A. Patented [4]
Benzamide derivative 7 DM7UEJT N. A. N. A. Patented [3]
Benzamide derivative 8 DMAIJHC N. A. N. A. Patented [3]
Benzamide derivative 9 DMVFSJZ N. A. N. A. Patented [3]
Bicyclo-heptan-2-amine derivative 1 DMGESCP N. A. N. A. Patented [4]
Bicyclo-heptan-2-amine derivative 2 DM9WUH5 N. A. N. A. Patented [4]
Bicyclo-heptan-2-amine derivative 3 DM8ZRXE N. A. N. A. Patented [4]
Bicyclo-heptan-2-amine derivative 4 DMPRIS0 N. A. N. A. Patented [4]
Fused aryl carbocycle derivative 1 DMFAM8B N. A. N. A. Patented [3]
Fused aryl carbocycle derivative 2 DMAQBJP N. A. N. A. Patented [3]
Fused aryl carbocycle derivative 3 DM5I4CA N. A. N. A. Patented [3]
Fused aryl carbocycle derivative 4 DMOU8T3 N. A. N. A. Patented [3]
Fused aryl carbocycle derivative 8 DMPBMEU N. A. N. A. Patented [3]
Fused aryl carbocycle derivative 9 DMQ2X6O N. A. N. A. Patented [3]
Isoindoline derivative 1 DMD19QC N. A. N. A. Patented [3]
Isoindoline derivative 2 DMTE0S3 N. A. N. A. Patented [3]
Isoindoline derivative 3 DM2MYL9 N. A. N. A. Patented [3]
Isoindoline derivative 4 DMP1NKI N. A. N. A. Patented [3]
Isoindoline derivative 5 DMIUTQW N. A. N. A. Patented [3]
N-substituted 9-azabicyclo[3.3.1]nonan-3alpha-yl-phenylcarbamate analog 1 DMSU80N N. A. N. A. Patented [4]
N-substituted 9-azabicyclo[3.3.1]nonan-3alpha-yl-phenylcarbamate analog 2 DMPW1GI N. A. N. A. Patented [4]
N-substituted 9-azabicyclo[3.3.1]nonan-3alpha-yl-phenylcarbamate analog 3 DMZF9TM N. A. N. A. Patented [4]
Piperazine derivative 7 DM9Y4ZV N. A. N. A. Patented [4]
Piperazinyl methyl quinazolinone derivative 1 DM7WOD9 N. A. N. A. Patented [3]
Piperazinyl methyl quinazolinone derivative 2 DM913KS N. A. N. A. Patented [3]
Piperazinyl methyl quinazolinone derivative 3 DMYH4AZ N. A. N. A. Patented [3]
Piperazinyl norbenzomorphane compound 1 DM3LKTE N. A. N. A. Patented [3]
Piperazinyl norbenzomorphane compound 2 DMD2CX1 N. A. N. A. Patented [3]
Piperazinyl norbenzomorphane compound 3 DMZYJKG N. A. N. A. Patented [3]
Piperazinyl norbenzomorphane compound 4 DMRSCJ7 N. A. N. A. Patented [3]
Piperidine derivative 5 DMQ0VK4 N. A. N. A. Patented [4]
Piperidine derivative 6 DM0GCTY N. A. N. A. Patented [4]
PMID28051882-Compound-Figure9 DMRANS2 N. A. N. A. Patented [4]
PMID28051882-Compound-XI DMLNA8P N. A. N. A. Patented [4]
PMID28051882-Compound-XIV DM1RN89 N. A. N. A. Patented [4]
PMID30185082-Compound-14 DMQU10C N. A. N. A. Patented [3]
PMID30185082-Compound-27 DMYFLT1 N. A. N. A. Patented [3]
PMID30185082-Compound-28 DMI0WHE N. A. N. A. Patented [3]
PMID30185082-Compound-53 DM9GX0F N. A. N. A. Patented [3]
PMID30185082-Compound-54 DMKP14O N. A. N. A. Patented [3]
PMID30185082-Compound-55 DMW8V4R N. A. N. A. Patented [3]
PMID30185082-Compound-56 DMLGKYI N. A. N. A. Patented [3]
PMID30185082-Compound-57 DMNDF1Z N. A. N. A. Patented [3]
PMID30185082-Compound-63 DMW2S0J N. A. N. A. Patented [3]
PMID30185082-Compound-64 DMKD470 N. A. N. A. Patented [3]
------------------------------------------------------------------------------------
⏷ Show the Full List of 52 Patented Agent(s)
1 Preclinical Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
ANAVEX 1007 DM2U16Z Melanoma 2C30 Preclinical [5]
------------------------------------------------------------------------------------
2 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
1,3-ditolylguanidine DM04KS1 Discovery agent N.A. Investigative [6]
SM 21 DM7MSGK Discovery agent N.A. Investigative [7]
------------------------------------------------------------------------------------

References

1 Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
2 Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
3 The sigma-2 (-2) receptor: a review of recent patent applications: 2013-2018.Expert Opin Ther Pat. 2018 Sep;28(9):655-663.
4 Are sigma modulators an effective opportunity for cancer treatment A patent overview (1996-2016).Expert Opin Ther Pat. 2017 May;27(5):565-578.
5 2011 Pipeline of Anavex.
6 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2553).
7 The analgesic tropane analogue (+/-)-SM 21 has a high affinity for sigma2 receptors. Life Sci. 1999;64(10):PL131-7.