Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTBYWP2)

• DTT Name: TYK2 tyrosine kinase (TYK2)
• Synonyms: Non-receptor tyrosine-protein kinase TYK2
• Gene Name: TYK2
• DTT Type: Clinical trial target; [1]
• BioChemical Class: Kinase
• UniProt ID: TYK2_HUMAN
• TTD ID: T78932
• EC Number: EC 2.7.10.2
• Sequence:
  MPLRHWGMARGSKPVGDGAQPMAAMGGLKVLLHWAGPGGGEPWVTFSESSLTAEEVCIHI
  AHKVGITPPCFNLFALFDAQAQVWLPPNHILEIPRDASLMLYFRIRFYFRNWHGMNPREP
  AVYRCGPPGTEASSDQTAQGMQLLDPASFEYLFEQGKHEFVNDVASLWELSTEEEIHHFK
  NESLGMAFLHLCHLALRHGIPLEEVAKKTSFKDCIPRSFRRHIRQHSALTRLRLRNVFRR
  FLRDFQPGRLSQQMVMVKYLATLERLAPRFGTERVPVCHLRLLAQAEGEPCYIRDSGVAP
  TDPGPESAAGPPTHEVLVTGTGGIQWWPVEEEVNKEEGSSGSSGRNPQASLFGKKAKAHK
  AVGQPADRPREPLWAYFCDFRDITHVVLKEHCVSIHRQDNKCLELSLPSRAAALSFVSLV
  DGYFRLTADSSHYLCHEVAPPRLVMSIRDGIHGPLLEPFVQAKLRPEDGLYLIHWSTSHP
  YRLILTVAQRSQAPDGMQSLRLRKFPIEQQDGAFVLEGWGRSFPSVRELGAALQGCLLRA
  GDDCFSLRRCCLPQPGETSNLIIMRGARASPRTLNLSQLSFHRVDQKEITQLSHLGQGTR
  TNVYEGRLRVEGSGDPEEGKMDDEDPLVPGRDRGQELRVVLKVLDPSHHDIALAFYETAS
  LMSQVSHTHLAFVHGVCVRGPENIMVTEYVEHGPLDVWLRRERGHVPMAWKMVVAQQLAS
  ALSYLENKNLVHGNVCGRNILLARLGLAEGTSPFIKLSDPGVGLGALSREERVERIPWLA
  PECLPGGANSLSTAMDKWGFGATLLEICFDGEAPLQSRSPSEKEHFYQRQHRLPEPSCPQ
  LATLTSQCLTYEPTQRPSFRTILRDLTRLQPHNLADVLTVNPDSPASDPTVFHKRYLKKI
  RDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKADCGPQHRSGWKQEIDILRTLYHEHII
  KYKGCCEDQGEKSLQLVMEYVPLGSLRDYLPRHSIGLAQLLLFAQQICEGMAYLHAQHYI
  HRDLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKEYKFYY
  ASDVWSFGVTLYELLTHCDSSQSPPTKFLELIGIAQGQMTVLRLTELLERGERLPRPDKC
  PCEVYHLMKNCWETEASFRPTFENLIPILKTVHEKYQGQAPSVFSVC
• Function: Probably involved in intracellular signal transduction by being involved in the initiation of type I IFN signaling. Phosphorylates the interferon-alpha/beta receptor alpha chain.
• KEGG Pathway:
  Osteoclast differentiation (hsa04380)
  Jak-STAT signaling pathway (hsa04630)
  Toxoplasmosis (hsa05145)
  Hepatitis C (hsa05160)
  Measles (hsa05162)
  Influenza A (hsa05164)
  Herpes simplex infection (hsa05168)
  Epstein-Barr virus infection (hsa05169)
• Reactome Pathway:
  MAPK3 (ERK1) activation (R-HSA-110056)
  MAPK1 (ERK2) activation (R-HSA-112411)
  Interferon alpha/beta signaling (R-HSA-909733)
  Regulation of IFNA signaling (R-HSA-912694)
  Interleukin-6 signaling (R-HSA-1059683)

Molecular Interaction Atlas (MIA) of This DTT

1 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Deucravacitinib	DMAR1YS	Plaque psoriasis	EA90.0	Approved	[1]

3 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
NDI-034858	DM2FJE7	Psoriatic arthritis	FA21	Phase 2	[2]
PF-06700841	DMMGSFV	Asthma	CA23	Phase 2	[1]
PF-06826647	DM5H8V1	Plaque psoriasis	EA90.0	Phase 2	[1]

35 Patented Agent(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Aminooxazole carboxamide derivative 1	DMDHGPN	N. A.	N. A.	Patented	[3]
Aminopyridine derivative 1	DMYE1A7	N. A.	N. A.	Patented	[3]
Aminopyrimidine derivative 5	DM5OZPV	N. A.	N. A.	Patented	[3]
Aminotriazolopyridine derivative 1	DMW2LZ0	N. A.	N. A.	Patented	[4]
Benzimidazole derivative 7	DMDK4RI	N. A.	N. A.	Patented	[4]
Bis-aminopyrimidine derivative 1	DMQL34C	N. A.	N. A.	Patented	[4]
Bis-aminopyrimidine derivative 2	DMJXNO1	N. A.	N. A.	Patented	[4]
Bis-aminopyrimidine derivative 3	DMUNSYX	N. A.	N. A.	Patented	[4]
Bis-aminopyrimidine derivative 4	DMO1ZIG	N. A.	N. A.	Patented	[4]
Bis-aminopyrimidine derivative 5	DMWXLK1	N. A.	N. A.	Patented	[4]
Imidazopyridine derivative 3	DMJCSL3	N. A.	N. A.	Patented	[3]
Imidazo[4,5-c]pyridine derivative 1	DM4KBZQ	N. A.	N. A.	Patented	[4]
Imidazo[4,5-c]pyridine derivative 2	DMFDRJT	N. A.	N. A.	Patented	[4]
N-methylmethanesulfonamide derivative 1	DMIVK7D	N. A.	N. A.	Patented	[3]
PMID27774822-Compound-Figure11Example5	DMAHFXV	N. A.	N. A.	Patented	[3]
PMID27774822-Compound-Figure3CompoundI-165	DMOENP4	N. A.	N. A.	Patented	[3]
PMID27774822-Compound-Figure9Example15	DMSHIT2	N. A.	N. A.	Patented	[3]
PMID27774824-Compound-Figure11Example1up	DMH1W8F	N. A.	N. A.	Patented	[4]
PMID27774824-Compound-Figure3Example18	DMYZ6XQ	N. A.	N. A.	Patented	[4]
PMID27774824-Compound-Figure6Example12	DM1CM7S	N. A.	N. A.	Patented	[4]
PMID27774824-Compound-Figure9Example2down	DMXAV42	N. A.	N. A.	Patented	[4]
PMID27774824-Compound-Figure9Example2up	DME3TMS	N. A.	N. A.	Patented	[4]
Pyrazolopyridine derivative 3	DM2VQ4P	N. A.	N. A.	Patented	[3]
Pyrazolopyridine derivative 5	DMTZCLG	N. A.	N. A.	Patented	[3]
Pyrazolo[4,3-c]pyridine derivative 2	DMCDFLQ	N. A.	N. A.	Patented	[4]
Pyrrole derivative 7	DMZCERW	N. A.	N. A.	Patented	[3]
Pyrrolo-pyridone derivative 3	DMUIK3W	N. A.	N. A.	Patented	[3]
Pyrrolo[2,3-d]pyrimidine derivative 6	DM3D1L6	N. A.	N. A.	Patented	[3]
Pyrrolo[2,3-d]pyrimidine derivative 7	DM30Y8M	N. A.	N. A.	Patented	[3]
Pyrrolo[2,3-d]pyrimidine derivative 8	DMAW6KU	N. A.	N. A.	Patented	[3]
Thiazolopyridine derivative 1	DMAFE5R	N. A.	N. A.	Patented	[3]
Tricyclic compound 11	DMJAZ7D	N. A.	N. A.	Patented	[3]
Tricyclic heterocycle derivative 1	DMXLJH4	N. A.	N. A.	Patented	[3]
Tricyclic heterocycle derivative 5	DMG1ESV	N. A.	N. A.	Patented	[3]
Tricyclic pyrrolopyridine compound 1	DMFIXW4	N. A.	N. A.	Patented	[3]

1 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
CMP-6	DM241YW	Discovery agent	N.A.	Investigative	[5]

References

• [1] Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
• [2] Clinical pipeline report, company report or official report of Nimbus Therapeutics
• [3] Inhibitors of JAK-family kinases: an update on the patent literature 2013-2015, part 2.Expert Opin Ther Pat. 2017 Feb;27(2):145-161.
• [4] Inhibitors of JAK-family kinases: an update on the patent literature 2013-2015, part 1.Expert Opin Ther Pat. 2017 Feb;27(2):127-143.
• [5] A systematic interaction map of validated kinase inhibitors with Ser/Thr kinases. Proc Natl Acad Sci U S A. 2007 Dec 18;104(51):20523-8.