Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTDGEC0)

• DTT Name: Immunoglobulin epsilon Fc receptor gamma (FCERG)
• Synonyms: IgE Fc receptor subunit gamma; High affinity immunoglobulin epsilon receptor subunit gamma; FceRI gamma; FcRgamma; Fc receptor gamma-chain
• Gene Name: FCER1G
• DTT Type: Successful target; [1]
• BioChemical Class: Immunoglobulin
• UniProt ID: FCERG_HUMAN
• TTD ID: T95400
• Sequence:
  MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEK
  SDGVYTGLSTRNQETYETLKHEKPPQ
• Function: As a component of the high-affinity immunoglobulin E (IgE) receptor, mediates allergic inflammatory signaling in mast cells. As a constitutive component of interleukin-3 receptor complex, selectively mediates interleukin 4/IL4 production by basophils, priming T-cells toward effector T-helper 2 subset. Associates with pattern recognition receptors CLEC4D and CLEC4E to form a functional signaling complex in myeloid cells. Binding of mycobacterial trehalose 6,6'-dimycolate (TDM) to this receptor complex leads to phosphorylation of ITAM, triggering activation of SYK, CARD9 and NF-kappa-B, consequently driving maturation of antigen-presenting cells and shaping antigen-specific priming of T-cells toward effector T-helper 1 and T-helper 17 cell subtypes. May function cooperatively with other activating receptors. Functionally linked to integrin beta-2/ITGB2-mediated neutrophil activation. Also involved in integrin alpha-2/ITGA2-mediated platelet activation. Adapter protein containing an immunoreceptor tyrosine-based activation motif (ITAM) that transduces activation signals from various immunoreceptors.
• KEGG Pathway:
  Sphingolipid signaling pathway (hsa04071)
  Fc epsilon RI signaling pathway (hsa04664)
  Asthma (hsa05310)
• Reactome Pathway:
  Role of LAT2/NTAL/LAB on calcium mobilization (R-HSA-2730905)
  FCERI mediated MAPK activation (R-HSA-2871796)
  FCERI mediated Ca+2 mobilization (R-HSA-2871809)
  FCERI mediated NF-kB activation (R-HSA-2871837)
  Fc epsilon receptor (FCERI) signaling (R-HSA-2454202)

Molecular Interaction Atlas (MIA) of This DTT

2 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Benzylpenicilloyl Polylysine	DMQHM2D	Bacterial infection	1A00-1C4Z	Approved	[1]
Omalizumab	DMETVFJ	Asthma	CA23	Approved	[2]

2 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Alpha-D-Mannose	DMF5DLW	Discovery agent	N.A.	Investigative	[3]
Fucose	DMAHMSV	N. A.	N. A.	Investigative	[3]

References

• [1] Penicillin allergy: anti-penicillin IgE antibodies and immediate hypersensitivity skin reactions employing major and minor determinants of penicillin. Arch Dis Child. 1980 Nov;55(11):857-60.
• [2] The potential of biologics for the treatment of asthma. Nat Rev Drug Discov. 2012 Dec;11(12):958-72.
• [3] How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.