Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTEX6LM)

• DTT Name: GABA(A) receptor gamma-3 (GABRG3)
• Synonyms: GABRG3
• Gene Name: GABRG3
• DTT Type: Successful target; [1]
• BioChemical Class: Ligand-gated ion channel
• UniProt ID: GBRG3_HUMAN
• TTD ID: T28722
• Sequence:
  MAPKLLLLLCLFSGLHARSRKVEEDEYEDSSSNQKWVLAPKSQDTDVTLILNKLLREYDK
  KLRPDIGIKPTVIDVDIYVNSIGPVSSINMEYQIDIFFAQTWTDSRLRFNSTMKILTLNS
  NMVGLIWIPDTIFRNSKTAEAHWITTPNQLLRIWNDGKILYTLRLTINAECQLQLHNFPM
  DEHSCPLIFSSYGYPKEEMIYRWRKNSVEAADQKSWRLYQFDFMGLRNTTEIVTTSAGDY
  VVMTIYFELSRRMGYFTIQTYIPCILTVVLSWVSFWIKKDATPARTALGITTVLTMTTLS
  TIARKSLPRVSYVTAMDLFVTVCFLFVFAALMEYATLNYYSSCRKPTTTKKTTSLLHPDS
  SRWIPERISLQAPSNYSLLDMRPPPTAMITLNNSVYWQEFEDTCVYECLDGKDCQSFFCC
  YEECKSGSWRKGRIHIDILELDSYSRVFFPTSFLLFNLVYWVGYLYL
• Function: Component of the heteropentameric receptor for GABA, the major inhibitory neurotransmitter in the vertebrate brain. Functions also as histamine receptor and mediates cellular responses to histamine. Functionsas receptor for diazepines and various anesthetics, such as pentobarbital; these are bound at a separate allosteric effector binding site. Functions as ligand- gated chloride channel.
• KEGG Pathway:
  Neuroactive ligand-receptor interaction (hsa04080)
  Retrograde endocannabinoid signaling (hsa04723)
  GABAergic synapse (hsa04727)
  Morphine addiction (hsa05032)
  Nicotine addiction (hsa05033)
• Reactome Pathway:
  GABA A receptor activation (R-HSA-977441)
  Ligand-gated ion channel transport (R-HSA-975298)

Molecular Interaction Atlas (MIA) of This DTT

14 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Allopregnanolone	DMNLHAC	Depression	6A70-6A7Z	approved	[2]
Bentazepam	DMRVBWU	Anxiety disorder	6B00-6B0Z	Approved	[1]
Clobazam - Lundbeck	DMW1OQ0	Anxiety disorder	6B00-6B0Z	Approved	[3]
Etomidate	DMZI3WO	Anaesthesia	9A78.6	Approved	[3]
Flumazenil	DMPCG2L	Benzodiazepine overdose	PC91	Approved	[4]
Ganaxolone	DMXJMKF	Epileptic seizures	8A61-8A6Z	Approved	[2]
Mebutamate	DM0KYI4	Anxiety disorder	6B00-6B0Z	Approved	[3]
Metharbital	DM5A38V	Epilepsy	8A60-8A68	Approved	[3]
Remimazolam	DMLVSYX	Procedural sedation	JB0C.3	Approved	[5]
Stiripentol	DMMSDOY	Dravet syndrome	8A61.11	Approved	[6]
Talbutal	DM214Q8	Irritability	MB24	Approved	[3]
Thiamylal	DMHDF7B	Anaesthesia	9A78.6	Approved	[3]
Zolpidem	DMWOSKJ	Insomnia	7A00-7A0Z	Approved	[4]
Zuranolone	DMGR98T	Postpartum depression	6E20.0	Approved	[2]

10 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Arbaclofen placarbil	DMO628K	Fragile X syndrome	LD55	Phase 3	[2]
Clomethiazole	DMSPN58	Stroke	8B20	Phase 3	[7]
Pagoclone	DMHWY2G	Anxiety disorder	6B00-6B0Z	Phase 2/3	[8]
Etazolate	DMOCID7	Neurodegenerative disorder	8A20-8A23	Phase 2	[9]
EVT-201	DMQGBM1	Insomnia	7A00-7A0Z	Phase 2	[4]
SARIPIDEM	DM5R89X	Anxiety disorder	6B00-6B0Z	Phase 2	[10]
T-2007	DMF9Z2T	Epilepsy	8A60-8A68	Phase 2	[4]
AZD-3043	DMXFYN0	Anaesthesia	9A78.6	Phase 1	[11]
NSD-788	DM5QHID	Anxiety disorder	6B00-6B0Z	Phase 1	[4]
Org-25435	DMBG534	Epilepsy	8A60-8A68	Phase 1	[12]

21 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Suriclone	DMC14HL	Anxiety disorder	6B00-6B0Z	Discontinued in Preregistration	[13]
Ocinaplon	DMQN3JX	Generalized anxiety disorder	6B00	Discontinued in Phase 3	[14]
Pazinaclone	DM1FST8	Anxiety disorder	6B00-6B0Z	Discontinued in Phase 3	[15]
Y-23684	DM3EZ68	Anxiety disorder	6B00-6B0Z	Discontinued in Phase 3	[16]
LORECLEZOLE	DMCZI62	Epileptic seizures	8A61-8A6Z	Discontinued in Phase 2	[17]
NGD 91-3	DMDAUCR	Anxiety disorder	6B00-6B0Z	Discontinued in Phase 2	[18]
RESEQUINIL	DM3EAYN	Epilepsy	8A60-8A68	Discontinued in Phase 2	[19]
RO-48-6791	DMH912O	Anxiety disorder	6B00-6B0Z	Discontinued in Phase 2	[20]
SL-65.1498	DMS8AHE	Anxiety disorder	6B00-6B0Z	Discontinued in Phase 2	[21]
Suritozole	DMDZ7AY	Major depressive disorder	6A70.3	Discontinued in Phase 2	[22]
CCD-3693	DMMEC1W	Anxiety disorder	6B00-6B0Z	Discontinued in Phase 1	[23]
CTP-354	DMXY43L	Pain	MG30-MG3Z	Discontinued in Phase 1	[24]
Org-21465	DMMYI9U	Anaesthesia	9A78.6	Discontinued in Phase 1	[25]
RO-48-8684	DMOX8AD	Anxiety disorder	6B00-6B0Z	Discontinued in Phase 1	[26]
Co-152791	DMU5TZD	Epilepsy	8A60-8A68	Terminated	[28]
Girisopam	DMSVMF2	Anxiety disorder	6B00-6B0Z	Terminated	[29]
NSD-721	DMF2XMA	Anxiety disorder	6B00-6B0Z	Terminated	[4]
Ro-19-8022	DMFRCM2	Anxiety disorder	6B00-6B0Z	Terminated	[30]
RU-33965	DMSWFMQ	Alzheimer disease	8A20	Terminated	[31]
ZK-91296	DMJYIVA	Alzheimer disease	8A20	Terminated	[32]
ZK-93426	DMMDQ5T	Alzheimer disease	8A20	Terminated	[33]

1 Preclinical Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
RWJ-51204	DMMVS07	Anxiety disorder	6B00-6B0Z	Preclinical	[27]

25 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
AA-29504	DMI59T7	Major depressive disorder	6A70.3	Investigative	[4]
alpha3IA	DM257WX	Discovery agent	N.A.	Investigative	[4]
alpha5IA	DMTU5QR	Discovery agent	N.A.	Investigative	[4]
C-21191	DMCAO3V	Anxiety disorder	6B00-6B0Z	Investigative	[4]
CP-409092	DMROYD7	Discovery agent	N.A.	Investigative	[34]
DMCM	DMK3WY4	Discovery agent	N.A.	Investigative	[4]
DOV-51892	DMQIK9S	Panic disorder	6B01	Investigative	[4]
GIDAZEPAM	DMASR6T	Anxiety disorder	6B00-6B0Z	Investigative	[35]
HZ-166	DMLU6VM	Neuropathic pain	8E43.0	Investigative	[4]
isonipecotic acid	DMO1ZHE	Discovery agent	N.A.	Investigative	[4]
JM-1232(-)	DMWMRO2	Anaesthesia	9A78.6	Investigative	[4]
NGD 96-3	DMWD7I3	Insomnia	7A00-7A0Z	Investigative	[4]
piperidine-4-sulphonic acid	DMMIZWE	Discovery agent	N.A.	Investigative	[4]
PNU 101017	DMKBCS2	Discovery agent	N.A.	Investigative	[36]
Ro-15-3505	DM4NW3U	Discovery agent	N.A.	Investigative	[37]
TBPS	DMFC3XP	Discovery agent	N.A.	Investigative	[4]
tetrahydrodeoxycorticosterone	DMF8M0W	Discovery agent	N.A.	Investigative	[4]
TP003	DMRHDGN	Discovery agent	N.A.	Investigative	[4]
UC-1011	DMCRFT5	Alzheimer disease	8A20	Investigative	[4]
UC-2024	DMJVT4K	Premenstrual syndrome	GA34.40	Investigative	[4]
UC-2029	DMGSOZ7	Premenstrual syndrome	GA34.40	Investigative	[4]
[18F]fluoroethylflumazenil	DMPWART	Discovery agent	N.A.	Investigative	[4]
[35S]TBPS	DMSD51L	Discovery agent	N.A.	Investigative	[4]
[3H]CGS8216	DMLP68J	Inflammation	1A00-CA43.1	Investigative	[4]
[3H]Ro154513	DMMBWKL	Discovery agent	N.A.	Investigative	[4]

References

• [1] Prodynorphin gene deletion increased anxiety-like behaviours, impaired the anxiolytic effect of bromazepam and altered GABAA receptor subunits gene expression in the amygdala. J Psychopharmacol. 2011Jan;25(1):87-96.
• [2] Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
• [3] Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
• [4] URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 415).
• [5] Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health Human Services. 2020
• [6] Stiripentol, a putative antiepileptic drug, enhances the duration of opening of GABA-A receptor channels. Epilepsia. 2006 Apr;47(4):704-16.
• [7] Electrophysiological actions of gamma-aminobutyric acid and clomethiazole on recombinant GABA(A) receptors. Eur J Pharmacol. 2002 Oct 11;452(3):255-62.
• [8] Evaluation of the abuse potential of pagoclone, a partial GABAA agonist. J Clin Psychopharmacol. 2006 Jun;26(3):268-73.
• [9] Etazolate, a neuroprotective drug linking GABA(A) receptor pharmacology to amyloid precursor protein processing. J Neurochem. 2008 Jul;106(1):392-404.
• [10] Behavioural effects of novel benzodiazepine (omega) receptor agonists and partial agonists: increases in punished responding and antagonism of the pentylenetetrazole cue. Behav Pharmacol. 1995 Mar;6(2):116-126.
• [11] AZD-3043: a novel, metabolically labile sedative-hypnotic agent with rapid and predictable emergence from hypnosis. Anesthesiology. 2012 Jun;116(6):1267-77.
• [12] First administration to man of Org 25435, an intravenous anaesthetic: A Phase 1 Clinical Trial. BMC Anesthesiol. 2010 Jun 29;10:10.
• [13] The effect of cyclopyrrolones on GABAA receptor function is different from that of benzodiazepines. Naunyn Schmiedebergs Arch Pharmacol. 1994 Sep;350(3):294-300.
• [14] Discriminative stimulus properties of GABAA receptor positive allosteric modulators TPA023, ocinaplon and NG2-73 in rats trained to discriminate chlordiazepoxide or zolpidem. Eur J Pharmacol. 2011 Oct 1;668(1-2):190-3.
• [15] The benzodiazepine binding site of GABA(A) receptors as a target for the development of novel anxiolytics. Expert Opin Investig Drugs. 2005 May;14(5):601-18.
• [16] The pharmacological properties of Y-23684, a benzodiazepine receptor partial agonist. Br J Pharmacol. 1994 Apr;111(4):1170-8.
• [17] Direct activation of GABAA receptors by loreclezole, an anticonvulsant drug with selectivity for the beta-subunit. Neuropharmacology. 1996;35(12):1753-60.
• [18] Anxioselective compounds acting at the GABA(A) receptor benzodiazepine binding site. Curr Drug Targets CNS Neurol Disord. 2003 Aug;2(4):213-32.
• [19] WO patent application no. 2010,0024,51, Naphthyridin derivatives.
• [20] Integrated pharmacokinetics and pharmacodynamics of Ro 48-6791, a new benzodiazepine, in comparison with midazolam during first administration to healthy male subjects. Br J Clin Pharmacol. 1997 Nov;44(5):477-86.
• [21] WO patent application no. 2005,0749,31, Pharmaceutical combinations comprising (s) -pantoprazole.
• [22] Chronic postinjury administration of MDL 26,479 (Suritozole), a negative modulator at the GABAA receptor, and cognitive impairment in rats following traumatic brain injury. J Neurosurg. 1995 Nov;83(5):878-83.
• [23] Interpreting expression profiles of cancers by genome-wide survey of breadth of expression in normal tissues. Genomics 2005 Aug;86(2):127-41.
• [24] Clinical pipeline report, company report or official report of Concert Pharmaceuticals.
• [25] Computer-controlled infusion of ORG 21465, a water soluble steroid i.v. anaesthetic agent, into human volunteers. Br J Anaesth. 1997 Oct;79(4):433-9.
• [26] Integrated pharmacokinetics and pharmacodynamics of Ro 48-8684, a new benzodiazepine, in comparison with midazolam during first administration to healthy male subjects. Br J Clin Pharmacol. 1997 Nov;44(5):487-93.
• [27] 5-ethoxymethyl-7-fluoro-3-oxo-1,2,3,5-tetrahydrobenzo[4,5]imidazo[1,2a]pyridine-4-N-(2-fluorophenyl)carboxamide (RWJ-51204), a new nonbenzodiazepine anxiolytic. J Pharmacol Exp Ther. 2002 Nov;303(2):777-90.
• [28] Substituted 3beta-phenylethynyl derivatives of 3alpha-hydroxy-5alpha-pregnan-20-one: remarkably potent neuroactive steroid modulators of gamma-aminobutyric acidA receptors. J Pharmacol Exp Ther. 1998Oct;287(1):198-207.
• [29] [(3)H]-girisopam, a novel selective benzodiazepine for the 2, 3-benzodiazepine binding site. Brain Res Brain Res Protoc. 1999 Jul;4(2):230-5.
• [30] Partial agonist of benzodiazepine receptors Ro 19-8022 elicits withdrawal symptoms after short-term administration in immature rats. Physiol Res. 2012;61(3):319-23.
• [31] Discriminative stimulus properties of RU 33965, a benzodiazepine receptor weak partial inverse agonist. Pharmacol Biochem Behav. 1992 Oct;43(2):583-8.
• [32] Enhancement of gamma-aminobutyric acid binding by the anxiolytic beta-carbolines ZK 93423 and ZK 91296. J Neurochem. 1987 May;48(5):1355-8.
• [33] Actions of the beta-carboline ZK 93426 in an animal test of anxiety and the holeboard: interactions with Ro 15-1788. J Neural Transm. 1986;65(2):103-14.
• [34] The ChEMBL database in 2017. Nucleic Acids Res. 2017 Jan 4;45(D1):D945-D954.
• [35] Discriminative effects of phenazepam and gidazepam in rats: comparison with other GABA-related drugs. Pharmacol Biochem Behav. 1999 Oct;64(2):397-401.
• [36] Neuroprotective effects of the GABA(A) receptor partial agonist U-101017 in 3-acetylpyridine-treated rats. Neurosci Lett. 1997 May 30;228(1):45-9.
• [37] Molecular structure and stereoelectronic properties of sarmazenil--a weak inverse agonist at the omega modulatory sites (benzodiazepine receptors):... Bioorg Med Chem. 1998 Oct;6(10):1745-57.