Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTF89GD)
| DTT Name | Interleukin-2 (IL2) | ||||
|---|---|---|---|---|---|
| Synonyms | TCGF; T-cell growth factor; IL-2; Aldesleukin | ||||
| Gene Name | IL2 | ||||
| DTT Type |
Successful target
|
[1] | |||
| BioChemical Class |
Cytokine: interleukin
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRML
TFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSE TTFMCEYADETATIVEFLNRWITFCQSIISTLT |
||||
| Function |
Produced by T-cells in response to antigenic or mitogenic stimulation, this protein is required for T-cell proliferation and other activities crucial to regulation of the immune response. Can stimulate B-cells, monocytes, lymphokine-activated killer cells, natural killer cells, and glioma cells.
|
||||
| KEGG Pathway |
|
||||
| Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
| Molecular Interaction Atlas (MIA) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
2 Approved Drug(s) Targeting This DTT
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
16 Clinical Trial Drug(s) Targeting This DTT
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
6 Discontinued Drug(s) Targeting This DTT
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
1 Preclinical Drug(s) Targeting This DTT
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
6 Investigative Drug(s) Targeting This DTT
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecular Expression Atlas (MEA) of This DTT
References
| 1 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. | ||||
|---|---|---|---|---|---|
| 2 | 2016 FDA drug approvals. Nat Rev Drug Discov. 2017 Feb 2;16(2):73-76. | ||||
| 3 | The AIR inhaled insulin system: system components and pharmacokinetic/glucodynamic data. Diabetes Technol Ther. 2007 Jun;9 Suppl 1:S41-7. | ||||
| 4 | A phase II study of Tg4010 (Mva-Muc1-Il2) in association with chemotherapy in patients with stage III/IV Non-small cell lung cancer. J Thorac Oncol. 2008 Jul;3(7):735-44. | ||||
| 5 | Clinical pipeline report, company report or official report of APEIRON Biologics. | ||||
| 6 | Clinical pipeline report, company report or official report of Bioniz Therapeutics. | ||||
| 7 | J Clin Oncol 32:5s, 2014 (suppl; abstr 2071). | ||||
| 8 | Clinical pipeline report, company report or official report of Immunservice. | ||||
| 9 | Immunotherapy of high-risk acute leukemia with a recipient (autologous) vaccine expressing transgenic human CD40L and IL-2 after chemotherapy and a... Blood. 2006 Feb 15;107(4):1332-41. | ||||
| 10 | National Cancer Institute Drug Dictionary (drug id 665656). | ||||
| 11 | Intratumoral interleukin 2 for renal-cell carcinoma by direct gene transfer of a plasmid DNA/DMRIE/DOPE lipid complex. World J Urol. 2000 Apr;18(2):152-6. | ||||
| 12 | Evaluation of efficacy and safety of thymus humoral factor-gamma 2 in the management of chronic hepatitis B. J Hepatol. 1995 Jul;23(1):21-7. | ||||
| 13 | Pharmacokinetics (PK) and immunologic responses in a phase I/II study of a sustained release formulation of IL-2 in renal cell carcinoma (RCC) patients. J Clin Oncol (Meeting Abstracts) June 2006 vol. 24 no. 18_suppl 2558. | ||||
| 14 | Genetic modification of human T lymphocytes for the treatment of hematologic malignancies. Haematologica. 2012 November; 97(11): 1622-1631. | ||||
| 15 | Interpreting expression profiles of cancers by genome-wide survey of breadth of expression in normal tissues. Genomics 2005 Aug;86(2):127-41. | ||||
| 16 | Clinical pipeline report, company report or official report of Astellas Pharma. | ||||
| 17 | Clinical pipeline report, company report or official report of Sanofi. | ||||
| 18 | Interleukin-2 gene therapy in a patient with glioblastoma. Gene Ther. 1995 Mar;2(2):164-7. | ||||
| 19 | Expression, purification and characterization of recombinant human interleukin-2-serum albumin (rhIL-2-HSA) fusion protein in Pichia pastoris. Protein Expr Purif. 2012 Jul;84(1):154-60. | ||||
| 20 | Development of a botanical anti-arthritis drug, PMI-001. SBIR.STTR America's Seed Fund. | ||||
| 21 | WO patent application no. 2013,1850,32, Nanotherapeutics for drug targeting. | ||||
| 22 | CN patent application no. 101039956, Cell surface glycoprotein. | ||||
| 23 | The novel immunomodulator, Linomide, stimulates interleukin-2-induced human natural killer (NK) cell and PHA-stimulated T cell proliferation from normal donors. Leuk Res. 1996 Jan;20(1):57-63. | ||||
| 24 | Melanoma and Immunotherapy. Hematology/Oncology Clinics of North America Volume 23, Issue 3, June 2009, Pages 547-564. | ||||
| 25 | BioPartnering North America--Programs from Pharma in Europe and the Middle East. IDrugs. 2010 Mar;13(3):162-5. | ||||
| 26 | An anti-IL-2 antibody increases serum half-life and improves anti-tumor efficacy of human recombinant interleukin-2. Immunopharmacology. 1994 Nov-Dec;28(3):223-32. | ||||
| 27 | Randomized study of recombinant interleukin-2 after autologous bone marrow transplantation for acute leukemia in first complete remission. Eur Cytokine Netw. 2000 Mar;11(1):91-8. | ||||
| 28 | How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | ||||
| 29 | Technology evaluation: TG-1031, Transgene SA.Curr Opin Mol Ther.2000 Feb;2(1):106-11. | ||||
| 30 | Immunotherapy of metastatic melanoma by intratumoral injections of Vero cells producing human IL-2: phase II randomized study comparing two dose le... Cancer Gene Ther. 2002 Mar;9(3):289-95. | ||||
