Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTJ8O14)

• DTT Name: Tumor suppressor candidate 2 (TUSC2)
• Synonyms: PDGFA-associated protein 2; PDAP2; LGCC; Fusion 1 protein; Fus-1 protein; FUS1; C3orf11
• Gene Name: TUSC2
• DTT Type: Clinical trial target; [1]
• UniProt ID: TUSC2_HUMAN
• TTD ID: T83376
• Sequence:
  MGASGSKARGLWPFASAAGGGGSEAAGAEQALVRPRGRAVPPFVFTRRGSMFYDEDGDLA
  HEFYEETIVTKNGQKRAKLRRVHKNLIPQGIVKLDHPRIHVDFPVILYEV
• Function: May function as a tumor suppressor, inhibiting colony formation, causing G1 arrest and ultimately inducing apoptosis in homozygous 3p21. 3 120-kb region-deficient cells.

Molecular Interaction Atlas (MIA) of This DTT

3 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
CNVN-202	DMWZOD7	Non-small-cell lung cancer	2C25.Y	Phase 1/2	[2]
Fus-1 tumor suppressor gene therapy	DMXV6YP	Non-small-cell lung cancer	2C25.Y	Phase 1/2	[1]
Quaratusugene ozeplasmid	DMZD7OA	Non-small-cell lung cancer	2C25.Y	Phase 1/2	[3]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Lung cancer	2C82	Lung tissue	3.62E-08	-0.16	-0.72

References

• [1] INGN 201: Ad-p53, Ad5CMV-p53, adenoviral p53, p53 gene therapy--introgen, RPR/INGN 201. Drugs R D. 2007;8(3):176-87.
• [2] Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800018766)
• [3] Clinical pipeline report, company report or official report of Genprex.