Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTK0943)

• DTT Name: Prostaglandin G/H synthase (COX)
• Synonyms: Prostaglandin-endoperoxide synthase; Prostaglandin H2 synthase; PHS; PGHS; PGH synthase; Cyclooxygenase; COX
• Gene Name: PTGS1
• DTT Type: Successful target; [1]
• BioChemical Class: Paired donor oxygen oxidoreductase
• UniProt ID: PGH1_HUMAN ; PGH2_HUMAN
• TTD ID: T03403
• Sequence:
  MSRSLLLWFLLFLLLLPPLPVLLADPGAPTPVNPCCYYPCQHQGICVRFGLDRYQCDCTR
  TGYSGPNCTIPGLWTWLRNSLRPSPSFTHFLLTHGRWFWEFVNATFIREMLMRLVLTVRS
  NLIPSPPTYNSAHDYISWESFSNVSYYTRILPSVPKDCPTPMGTKGKKQLPDAQLLARRF
  LLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQ
  YQLRLFKDGKLKYQVLDGEMYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLY
  ATLWLREHNRVCDLLKAEHPTWGDEQLFQTTRLILIGETIKIVIEEYVQQLSGYFLQLKF
  DPELLFGVQFQYRNRIAMEFNHLYHWHPLMPDSFKVGSQEYSYEQFLFNTSMLVDYGVEA
  LVDAFSRQIAGRIGGGRNMDHHILHVAVDVIRESREMRLQPFNEYRKRFGMKPYTSFQEL
  VGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNPICS
  PEYWKPSTFGGEVGFNIVKTATLKKLVCLNTKTCPYVSFRVPDASQDDGPAVERPSTEL
• Function: Converts arachidonate to prostaglandin H2 (PGH2), a committed step in prostanoid synthesis. PTGS1 is involved in the constitutive production of prostanoids in particular in the stomach and platelets. It is a key step in the generation of prostaglandins in gastric epithelial cells and the generation of thromboxane A2 (TXA2) in platelets. PTGS2 is constitutively expressed in some tissues in physiological conditions, such as the endothelium, kidney and brain, and in pathological conditions, such as in cancer. PTGS2 is responsible for production of inflammatory prostaglandins. Up-regulation of PTGS2 is also associated with increased cell adhesion, phenotypic changes, resistance to apoptosis and tumor angiogenesis.
• KEGG Pathway:
  Arachidonic acid metabolism (hsa00590)
  Metabolic pathways (hsa01100)
  Platelet activation (hsa04611)
  Serotonergic synapse (hsa04726)
  Regulation of lipolysis in adipocytes (hsa04923)
• Reactome Pathway:
  Synthesis of Prostaglandins (PG) and Thromboxanes (TX) (R-HSA-2162123)
  COX reactions (R-HSA-140180)
• BioCyc Pathway: MetaCyc:HS01815-MON

Molecular Interaction Atlas (MIA) of This DTT

20 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Aceclofenac	DMZDF0B	Inflammation	1A00-CA43.1	Approved	[2]
Acetaminophen	DMUIE76	Allergic rhinitis	CA08.0	Approved	[3]
Ampiroxicam	DM5BS98	Inflammation	1A00-CA43.1	Approved	[4]
Amtolmetin guacil	DMAWU35	Inflammation	1A00-CA43.1	Approved	[5]
Asasantin	DMCZIHT	Cerebrovascular ischaemia	8B1Z	Approved	[6]
Aspirin	DM672AH	Acute coronary syndrome	BA41	Approved	[7]
Dexibuprofen	DMFYBD0	Ankylosing spondylitis	FA92.0	Approved	[8]
Diclofenac	DMPIHLS	Chronic renal failure	GB61.Z	Approved	[1]
Felbinac	DMKZEIB	Arthritis	FA20	Approved	[9]
Fenoprofen	DML5VQ0	Osteoarthritis	FA00-FA05	Approved	[10]
Fosfosal	DMDIC39	Pain	MG30-MG3Z	Approved	[11]
Icosapent	DMJHN0A	Hyperglyceridemia	5C80.1	Approved	[12]
Ketorolac	DMI4EL5	Postoperative inflammation	1A00-CA43.1	Approved	[13]
Lornoxicam	DMYZFXN	Migraine	8A80	Approved	[14]
Loxoprofen gel	DMQMGXV	Inflammation	1A00-CA43.1	Approved	[15]
Meclofenamic acid	DM05FXR	Ankylosing spondylitis	FA92.0	Approved	[16]
Morniflumate	DM9UTDE	Otitis media	AA80-AB0Z	Approved	[17]
Nepafenac	DMYK490	Osteoarthritis	FA00-FA05	Approved	[18]
Oxaprozin	DM9UB0P	Osteoarthritis	FA00-FA05	Approved	[10]
Pelubiprofen	DM8DQV9	Back pain	ME84.Z	Approved	[19]

8 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
K-103-IP	DM9J0KD	Pain	MG30-MG3Z	Phase 3	[20]
Naproxcinod	DMKP45D	Inflammation	1A00-CA43.1	Phase 3	[21]
BN82451	DMUM2KA	Parkinson disease	8A00.0	Phase 2	[22]
NCX 1022	DM4W28K	Atopic dermatitis	EA80	Phase 2	[23]
NCX-4016	DMOX1CU	Inflammation	1A00-CA43.1	Phase 2	[6]
TZI-41078	DMKJIDU	Arthritis	FA20	Phase 2	[24]
4-aminosalicylate sodium	DM4Z1CH	Inflammatory bowel disease	DD72	Phase 1	[25]
SKF-105809	DMUN7EQ	Pain	MG30-MG3Z	Phase 1	[26]

19 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Droxicam	DMRZ5D7	Inflammation	1A00-CA43.1	Withdrawn from market	[27]
Zomepirac	DM7APNJ	Pain	MG30-MG3Z	Withdrawn from market	[28]
Bermoprofen	DM7BN1A	Inflammation	1A00-CA43.1	Discontinued in Preregistration	[29]
Pirazolac	DMP6BG4	Inflammation	1A00-CA43.1	Discontinued in Preregistration	[30]
KC-764	DM1AFPW	Platelet aggregation disorder	3B62	Discontinued in Phase 3	[31]
Benzydamine	DMEQL9U	Chemotherapy or radiotherapy-induced mucositis	DA42-DA60	Discontinued in Phase 2	[32]
D-7193	DMO9HWU	Immune System disease	4A01-4B41	Discontinued in Phase 2	[33]
FS-205-397	DMJLEV7	Pain	MG30-MG3Z	Discontinued in Phase 2	[34]
NCX-701	DMWROJ5	Pain	MG30-MG3Z	Discontinued in Phase 2	[35]
PSD-508	DMR1OJM	Dysmenorrhea	GA34.3	Discontinued in Phase 2	[36]
D-1367	DMB24V7	Arthritis	FA20	Discontinued in Phase 1	[37]
Eltenac	DMWRQG7	Arthritis	FA20	Discontinued in Phase 1	[38]
F-11105	DMLRF7U	Asthma	CA23	Discontinued in Phase 1	[33]
E-5110	DMR861Q	Inflammation	1A00-CA43.1	Terminated	[39]
Florifenine	DMDVAI5	Inflammation	1A00-CA43.1	Terminated	[40]
NMI-1182	DM5IFU9	Inflammation	1A00-CA43.1	Terminated	[41]
RP-66364	DM6HJX7	Inflammation	1A00-CA43.1	Terminated	[42]
S-14080	DM759KX	Inflammation	1A00-CA43.1	Terminated	[43]
WY-28342	DMAG86C	Rheumatoid arthritis	FA20	Terminated	[44]

References

• [1] Diclofenac and NS-398, a selective cyclooxygenase-2 inhibitor, decrease agonist-induced contractions of the pig isolated ureter. Urol Res. 2000 Dec;28(6):376-82.
• [2] Aceclofenac spares cyclooxygenase 1 as a result of limited but sustained biotransformation to diclofenac. Clin Pharmacol Ther. 2003 Sep;74(3):222-35.
• [3] Mechanism of action of paracetamol. Am J Ther. 2005 Jan-Feb;12(1):46-55.
• [4] Premedication with cyclooxygenase-2 inhibitor meloxicam reduced postoperative pain in patients after oral surgery. Int J Oral Maxillofac Surg. 2006 Jul;35(7):613-7.
• [5] Gastrointestinal safety of amtolmetin guacyl in comparison with celecoxib in patients with rheumatoid arthritis. Clin Exp Rheumatol. 2005 Nov-Dec;23(6):809-18.
• [6] Emerging drugs in peripheral arterial disease. Expert Opin Emerg Drugs. 2006 Mar;11(1):75-90.
• [7] Cyclooxygenase inhibitors: instrumental drugs to understand cardiovascular homeostasis and arterial thrombosis. Cardiovasc Hematol Disord Drug Targets. 2008 Dec;8(4):268-77.
• [8] Comparison of the efficacy and tolerability of dexibuprofen and celecoxib in the treatment of osteoarthritis of the hip. Int J Clin Pharmacol Ther. 2003 Apr;41(4):153-64.
• [9] A review of the effects of fenbufen and a metabolite, biphenylacetic acid, on platelet biochemistry and function. Arzneimittelforschung. 1980;30(4A):702-7.
• [10] The aryl propionic acid R-flurbiprofen selectively induces p75NTR-dependent decreased survival of prostate tumor cells. Cancer Res. 2007 Apr 1;67(7):3254-62.
• [11] Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77.
• [12] Differential modulation of Toll-like receptors by fatty acids: preferential inhibition by n-3 polyunsaturated fatty acids. J Lipid Res. 2003 Mar;44(3):479-86.
• [13] Cyclooxygenase and nitric oxide synthase dependence of cutaneous reactive hyperemia in humans. Am J Physiol Heart Circ Physiol. 2007 Jul;293(1):H425-32.
• [14] The analgesic NSAID lornoxicam inhibits cyclooxygenase (COX)-1/-2, inducible nitric oxide synthase (iNOS), and the formation of interleukin (IL)-6 in vitro. Inflamm Res. 1999 Jul;48(7):369-79.
• [15] Comparative study of the clinical efficacy of the selective cyclooxygenase-2 inhibitor celecoxib compared with loxoprofen in patients with frozen shoulder. Mod Rheumatol. 2014 Jan;24(1):144-9.
• [16] Interactions of PGH synthase isozymes-1 and -2 with NSAIDs. Ann N Y Acad Sci. 1994 Nov 15;744:50-7.
• [17] Modulation of arachidonic acid metabolism by orally administered morniflumate in man. Agents Actions. 1991 Jul;33(3-4):233-9.
• [18] Topical nepafenac inhibits ocular neovascularization. Invest Ophthalmol Vis Sci. 2003 Jan;44(1):409-15.
• [19] Anti-inflammatory effect of pelubiprofen, 2-[4-(oxocyclohexylidenemethyl)-phenyl]propionic acid, mediated by dual suppression of COX activity and LPS-induced inflammatory gene expression via NF- B inactivation. J Cell Biochem. 2011 Dec;112(12):3594-603.
• [20] ClinicalTrials.gov (NCT02089425) An Efficacy and Safety Study for the Treatment of Mild to Moderate Acute Pain Associated With Ankle Strain or Sprain.. U.S. National Institutes of Health.
• [21] Naproxcinod, a new cyclooxygenase-inhibiting nitric oxide donator (CINOD). Expert Opin Biol Ther. 2009 May;9(5):649-57.
• [22] Emerging drug therapies in Huntington's disease. Expert Opin Emerg Drugs. 2009 Jun;14(2):273-97.
• [23] Anti-inflammatory effects of nitric oxide-releasing hydrocortisone NCX 1022, in a murine model of contact dermatitis. Br J Pharmacol. 2004 Nov;143(5):618-25.
• [24] Hydroxylamine analogs of 2,6-di-t-butylphenols: dual inhibitors of cyclooxygenase and 5-lipoxygenase or selective 5-lipoxygenase inhibitors. Bioorg Med Chem. 1995 Apr;3(4):403-10.
• [25] 5-aminosalicylic acid mediates expression of cyclooxygenase-2 and 15-hydroxyprostaglandin dehydrogenase to suppress colorectal tumorigenesis. Anticancer Res. 2012 Apr;32(4):1193-202.
• [26] Analgetic activity of SK&F 105809, a dual inhibitor of arachidonic acid metabolism. Agents Actions Suppl. 1991;32:113-7.
• [27] Pharmacokinetic profile of droxicam. Eur J Rheumatol Inflamm. 1991;11(4):10-4.
• [28] Effect of preischemia cyclooxygenase inhibition by zomepirac sodium on reflow, cerebral autoregulation, and EEG recovery in the cat after global ischemia. J Cereb Blood Flow Metab. 1986 Dec;6(6):691-702.
• [29] Prolongation of antipyretic action and reduction of gastric ulcerogenicity in the rat by controlled-release granules of bermoprofen, a new nonsteroidal anti-inflammatory drug. J Pharm Sci. 1991 Sep;80(9):876-80.
• [30] Differential dosing study of pirazolac, a new non-steroidal anti-inflammatory agent, in patients with rheumatoid arthritis. Curr Med Res Opin. 1985;9(8):542-7.
• [31] Clinical and preclinical pharmacology of KC-764, a novel antiplatelet agent. Nihon Rinsho. 1992 Feb;50(2):379-84.
• [32] Emerging drugs for chemotherapy-induced mucositis. Expert Opin Emerg Drugs. 2008 Sep;13(3):511-22.
• [33] US patent application no. 6,673,908, Tumor necrosis factor receptor 2.
• [34] FS 205-397: a new antipyretic analgesic with a paracetamol-like profile of activity but lack of acute hepatotoxicity in mice. Life Sci. 1988;43(11):905-12.
• [35] Antinociceptive effects of NCX-701 (nitro-paracetamol) in neuropathic rats: enhancement of antinociception by co-administration with gabapentin. Br J Pharmacol. 2009 September; 158(2): 601-609.
• [36] CN patent application no. 104797935, A method for prognosis and treatment of cancer metastasis.
• [37] US patent application no. 2007,0072,861, Method of using cyclooxygenase-2 inhibitors in the prevention of cardiovascular disorders.
• [38] Effect of eltenac in horses with induced endotoxaemia. Equine Vet J Suppl. 2000 Jun;(32):26-31.
• [39] Effect of E-5110, a novel non-steroidal anti-inflammatory drug, on trimethadione metabolism as an indicator of hepatic drug-oxidizing capacity in beagle dog. Xenobiotica. 1994 Mar;24(3):215-20.
• [40] A study of the novel anti-inflammatory agent florifenine topical anti-inflammatory activity and influence on arachidonic acid metabolism and neutrophil functions. Naunyn Schmiedebergs Arch Pharmacol.1995 Mar;351(3):298-304.
• [41] NMI-1182, a gastro-protective cyclo-oxygenase-inhibiting nitric oxide donor. Inflammopharmacology. 2005;12(5-6):521-34.
• [42] WO patent application no. 1997,0297,75, Compositions comprising a cyclooxygenase-2 inhibitor and a leukotriene b4 receptor antagonist.
• [43] US patent application no. 7,022,689, 5-amidino-n-(2-aminophenethyl)-n-hydroxy-benzenesulffonamide derivative, medical composition containing the same, pharmaceutical use thereof and intermediate therefor.
• [44] Synthesis and antiinflammatory activity of certain 5,6,7,8-tetrahydroquinolines and related compounds. J Med Chem. 1995 Apr 28;38(9):1473-81.