Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTKSND3)
| DTT Name | Lectin-like oxidized LDL receptor (OLR1) | ||||
|---|---|---|---|---|---|
| Synonyms |
hLOX-1; Oxidized low-density lipoprotein receptor 1; Oxidized low-density lipoprotein receptor; Oxidised low density lipoprotein (Lectin-like) receptor 1; Ox-LDL receptor 1; Lectin-type oxidized LDL receptor 1; Lectin-type oxidized LDL receptor; Lectin-like oxidized low-density lipoprotein receptor-1; Lectin-like oxidized LDL receptor-1; Lectin-like oxidized LDL receptor 1; Lectin-like oxLDL receptor 1; LOX1; LOX-1; CLEC8A; C-type lectin domain family 8 member A
|
||||
| Gene Name | OLR1 | ||||
| DTT Type |
Discontinued target
|
[1] | |||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MTFDDLKIQTVKDQPDEKSNGKKAKGLQFLYSPWWCLAAATLGVLCLGLVVTIMVLGMQL
SQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQ MELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLL KINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPS GTCAYIQRGAVYAENCILAAFSICQKKANLRAQ |
||||
| Function |
OxLDL is a marker of atherosclerosis that induces vascular endothelial cell activation and dysfunction, resulting in pro-inflammatory responses, pro-oxidative conditions and apoptosis. Its association with oxLDL induces the activation of NF-kappa-B through an increased production of intracellular reactive oxygen and a variety of pro-atherogenic cellular responses including a reduction of nitric oxide (NO) release, monocyte adhesion and apoptosis. In addition to binding oxLDL, it acts as a receptor for the HSP70 protein involved in antigen cross-presentation to naive T-cells in dendritic cells, thereby participating in cell-mediated antigen cross-presentation. Also involved in inflammatory process, by acting as a leukocyte-adhesion molecule at the vascular interface in endotoxin-induced inflammation. Also acts as a receptor for advanced glycation end (AGE) products, activated platelets, monocytes, apoptotic cells and both Gram-negative and Gram-positive bacteria. Receptor that mediates the recognition, internalization and degradation of oxidatively modified low density lipoprotein (oxLDL) by vascular endothelial cells.
|
||||
| KEGG Pathway | |||||
| Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
1 Clinical Trial Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||
|
1 Discontinued Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||
