Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTQ79W8)
| DTT Name | Apoptosis regulator Bcl-W (BCL-W) | ||||
|---|---|---|---|---|---|
| Synonyms | KIAA0271; Bcl2-L-2; Bcl-2-like protein 2; BCLW | ||||
| Gene Name | BCL2L2 | ||||
| DTT Type |
Clinical trial target
|
[1] | |||
| BioChemical Class |
B-cell lymphoma Bcl-2
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRT
FSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVG QVQEWMVAYLETQLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVAL GALVTVGAFFASK |
||||
| Function | Blocks dexamethasone-induced apoptosis. Mediates survival of postmitotic Sertoli cells by suppressing death-promoting activity of BAX. Promotes cell survival. | ||||
| KEGG Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
1 Clinical Trial Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||
|
1 Patented Agent(s) Targeting This DTT
|
||||||||||||||||||||||||||||
