Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTRV7FQ)

DTT Name	Enterobacteria Shiga-like toxin 2B (EntBac stxB2)
Synonyms	stxB2; Verotoxin 2 subunit B; Verocytotoxin 2 subunit B; Shiga-like toxin 2 subunit B; SLT-IIb; SLT-2b; SLT-2 B subunit
Gene Name	EntBac stxB2
DTT Type	Discontinued target	[1]
BioChemical Class	Shiga-like toxin beta
UniProt ID	STXB_BP933
TTD ID	T71011
Sequence	MKKMFMAVLFALASVNAMAADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQS AQLTGMTVTIKSSTCESGSGFAEVQFNND
Function	TheB subunit is responsible for the binding of the holotoxin to specific receptors on the target cell surface, such as globotriaosylceramide (Gb3) in human intestinal microvilli.

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DTT

1 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Urtoxazumab	DMBJ8KG	Escherichia coli infection	1A03	Discontinued in Phase 2	[1]
------------------------------------------------------------------------------------

References

1	Safety and pharmacokinetics of urtoxazumab, a humanized monoclonal antibody, against Shiga-like toxin 2 in healthy adults and in pediatric patients infected with Shiga-like toxin-producing Escherichia coli. Antimicrob Agents Chemother. 2010 Jan;54(1):239-43.