Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTV2A1R)

DTT Name	Oxalosuccinate decarboxylase (IDH1)
Synonyms	PICD; NADP(+)-specific ICDH; Isocitrate dehydrogenase [NADP] cytoplasmic; IDP; IDH; Cytosolic NADP-isocitrate dehydrogenase
Gene Name	IDH1
DTT Type	Successful target	[1]
BioChemical Class	Short-chain dehydrogenases reductase
UniProt ID	IDHC_HUMAN
TTD ID	T69563
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
EC Number	EC 1.1.1.42
Sequence	MSKKISGGSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDA AEAIKKHNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRL VSGWVKPIIIGRHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAM GMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSQFE AQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLVCPDG KTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRGLAHRAKLDNNKELAFFANALE EVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAKL
Function	Catalyses the NADPH-dependent reduction of alpha-ketoglutarate to R(-)-2-hydroxyglutarate (2HG).
KEGG Pathway	Citrate cycle (TCA cycle) (hsa00020 ) Glutathione metabolism (hsa00480 ) Metabolic pathways (hsa01100 ) Biosynthesis of antibiotics (hsa01130 ) Carbon metabolism (hsa01200 ) 2-Oxocarboxylic acid metabolism (hsa01210 ) Biosynthesis of amino acids (hsa01230 ) Peroxisome (hsa04146 ) Central carbon metabolism in cancer (hsa05230 )
Reactome Pathway	NADPH regeneration (R-HSA-389542 ) Neutrophil degranulation (R-HSA-6798695 ) Peroxisomal protein import (R-HSA-9033241 ) Nuclear events mediated by NFE2L2 (R-HSA-9759194 ) Abnormal conversion of 2-oxoglutarate to 2-hydroxyglutarate (R-HSA-2978092 )
BioCyc Pathway	MetaCyc:HS06502-MON

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DTT

2 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Ivosidenib	DM8S6T7	Acute myeloid leukaemia	2A60	Approved	[1]
Olutasidenib	DMPH916	Acute myeloid leukaemia	2A60	Approved	[2]
------------------------------------------------------------------------------------

2 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
IDH305	DMNWPMO	Advanced malignancy	2A00-2F9Z	Phase 1	[3]
LY3410738	DMFU0H5	Solid tumour/cancer	2A00-2F9Z	Phase 1	[4]
------------------------------------------------------------------------------------

References

1	2018 FDA drug approvals.Nat Rev Drug Discov. 2019 Feb;18(2):85-89.
2	FDA Approved Drug Products from FDA Official Website. 2022. Application Number: 215814.
3	Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
4	LY3410738, a novel inhibitor of mutant IDH1 is more effective than Ivosidenib and potentiates antileukemic activity of standard chemotherapy in preclinical models of acute myeloid leukemia (AML). Cancer Res 2020;80(16 Suppl):Abstract nr 6417.