Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T80387
|
||||
| Former ID |
TTDS00410
|
||||
| Target Name |
Gamma-aminobutyric acid receptor subunit beta-2
|
||||
| Gene Name |
GABRB2
|
||||
| Synonyms |
GABA(A) receptor subunit beta-2; GABRB2
|
||||
| Target Type |
Successful
|
||||
| Disease | Anxiety disorder [ICD9: 300, 311; ICD10: F32, F40-F42] | ||||
| Epileptic seizures [ICD9: 345.9, 780.3; ICD10: G40, P90, R56] | |||||
| Inflammation [ICD10: E08-E13, E10.2, E11, E11.2, E13.2, I73.9, I80-I82, N00-N29, G89] | |||||
| Insomnia [ICD9: 307.41, 307.42, 327.0, 780.51, 780.52; ICD10: F51.0, G47.0] | |||||
| Muscle spasm [ICD10: M62.838] | |||||
| Premenstrual syndrome [ICD10: N94.3] | |||||
| Function |
Component of the heteropentameric receptor for GABA, the major inhibitory neurotransmitter in the vertebrate brain. Functions also as histamine receptor and mediates cellular responses to histamine. Functions as receptor for diazepines and various anesthetics, such as pentobarbital; these are bound at a separate allosteric effector binding site. Functions as ligand- gated chloride channel.
|
||||
| BioChemical Class |
Neurotransmitter receptor
|
||||
| Target Validation |
T80387
|
||||
| UniProt ID | |||||
| Sequence |
MWRVRKRGYFGIWSFPLIIAAVCAQSVNDPSNMSLVKETVDRLLKGYDIRLRPDFGGPPV
AVGMNIDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDT YFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIES YGYTTDDIEFYWRGDDNAVTGVTKIELPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKR NIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIP YVKAIDMYLMGCFVFVFMALLEYALVNYIFFGRGPQRQKKAAEKAASANNEKMRLDVNKI FYKDIKQNGTQYRSLWDPTGNLSPTRRTTNYDFSLYTMDPHENILLSTLEIKNEMATSEA VMGLGDPRSTMLAYDASSIQYRKAGLPRHSFGRNALERHVAQKKSRLRRRASQLKITIPD LTDVNAIDRWSRIFFPVVFSFFNIVYWLYYVN |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Ethchlorvynol | Drug Info | Approved | Insomnia | [538355], [542191] |
| THIOCOLCHICOSIDE | Drug Info | Approved | Muscle spasm | [551871] | |
| ZK-93423 | Drug Info | Phase 3 | Epileptic seizures | [467683], [533661] | |
| ALLOPREGNANOLONE | Drug Info | Phase 2 | Discovery agent | [467451], [524035] | |
| ELTANOLONE | Drug Info | Discontinued in Phase 3 | Premenstrual syndrome | [546011] | |
| U-78875 | Drug Info | Discontinued in Phase 1 | Anxiety disorder | [544810] | |
| CGS-9896 | Drug Info | Terminated | Discovery agent | [544687] | |
| Inhibitor | (2E,4S)-4-ammoniopent-2-enoate | Drug Info | [533514] | ||
| (4R)-4-ammoniopentanoate | Drug Info | [533514] | |||
| (4S)-4-ammoniopentanoate | Drug Info | [533514] | |||
| (9-Benzyl-9H-purin-6-yl)-cyclopropyl-amine | Drug Info | [533033] | |||
| 1,1-Dimethyl-5-oxa-spiro[2.4]heptan-4-one | Drug Info | [533975] | |||
| 1-(4-chlorophenyl)-4-phenyl-1H-imidazole | Drug Info | [528080] | |||
| 1-Methyl-5-oxa-spiro[2.4]heptan-4-one | Drug Info | [533975] | |||
| 2-(4-chlorophenyl)-5-phenyl-4-isoxazolin-3-one | Drug Info | [528080] | |||
| 2-(9-Benzyl-9H-purin-6-ylamino)-ethanol | Drug Info | [533033] | |||
| 2-Isoxazol-5-yl-3H-imidazo[4,5-c]quinoline | Drug Info | [534155] | |||
| 2-Oxa-spiro[4.4]nonan-1-one | Drug Info | [533975] | |||
| 2-Thiophen-2-yl-3H-imidazo[4,5-c]quinoline | Drug Info | [534155] | |||
| 3,3-Diethyl-dihydro-furan-2-one | Drug Info | [533975] | |||
| 3,3-Diisopropyl-dihydro-furan-2-one | Drug Info | [533975] | |||
| 3-amino-3-demethoxythiocolchicine | Drug Info | [528408] | |||
| 3-butoxycarbonyl-4-quinolone | Drug Info | [528134] | |||
| 3-butoxycarbonyl-6-ethyl-4-quinolone | Drug Info | [528134] | |||
| 3-butylaminocarbonyl-6-ethyl-4-quinolone | Drug Info | [528134] | |||
| 3-carboxy-6-ethyl-4-quinolone | Drug Info | [528134] | |||
| 3-cyclopentoxycarbonyl-6-ethyl-4-quinolone | Drug Info | [528134] | |||
| 3-demethoxy-3-D-lyxopyranosylaminothiocolchicine | Drug Info | [528408] | |||
| 3-demethoxy-3-D-mannopyranosylaminothiocolchicine | Drug Info | [528408] | |||
| 3-demethoxy-3-D-xylopyranosylaminothiocolchicine | Drug Info | [528408] | |||
| 3-demethoxy-3-L-fucopyranosylaminothiocolchicine | Drug Info | [528408] | |||
| 3-demethoxy-3D-glucopyranosylaminothiocolchicine | Drug Info | [528408] | |||
| 3-ethoxycarbonyl-4-quinolone | Drug Info | [528134] | |||
| 3-ethoxycarbonyl-6-ethyl-2-methyl-4-quinolone | Drug Info | [528134] | |||
| 3-ethoxycarbonyl-6-propyl-4-quinolone | Drug Info | [528134] | |||
| 3-Ethyl-3-isopropyl-dihydro-furan-2-one | Drug Info | [533975] | |||
| 3-Ethyl-3-methyl-dihydro-furan-2-one | Drug Info | [533975] | |||
| 3-Isopropyl-3-methyl-dihydro-furan-2-one | Drug Info | [533975] | |||
| 3-Isothiocyanato-9H-beta-carboline | Drug Info | [531518] | |||
| 3-Methyl-9H-beta-carboline | Drug Info | [533745] | |||
| 3-tert-Butyl-3-ethyl-dihydro-furan-2-one | Drug Info | [533975] | |||
| 4-(2-aminoethyl)-1,2,5-oxadiazol-3-ol | Drug Info | [528295] | |||
| 4-(4-chlorophenyl)-1-pyrid-2-yl-pyrazole | Drug Info | [528080] | |||
| 4-(biphenyl-3-yl)-5-(piperidin-4-yl)isoxazol-3-ol | Drug Info | [530818] | |||
| 4-Benzyl-5-piperidin-4-yl-isoxazol-3-ol | Drug Info | [527382] | |||
| 4-Naphthalen-1-yl-5-piperidin-4-yl-isoxazol-3-ol | Drug Info | [527382] | |||
| 4-Naphthalen-2-yl-5-piperidin-4-yl-isoxazol-3-ol | Drug Info | [527382] | |||
| 4-Phenyl-5-piperidin-4-yl-isoxazol-3-ol | Drug Info | [527382] | |||
| 5-(piperidin-4-yl)isoxazol-3-ol | Drug Info | [527382] | |||
| 5-[(1R)-1-ammonioethyl]isoxazol-3-olate | Drug Info | [533514] | |||
| 5-[(1S)-1-ammonioethyl]isoxazol-3-olate | Drug Info | [533514] | |||
| 6,6-Dimethyl-2-oxa-spiro[4.4]nonan-1-one | Drug Info | [533975] | |||
| 6,9-Dimethyl-2-oxa-spiro[4.4]nonan-1-one | Drug Info | [533975] | |||
| 6-benzyl-3-ethoxycarbonyl-4-quinolone | Drug Info | [528134] | |||
| 6-benzyl-3-propoxycarbonyl-4-quinolone | Drug Info | [528134] | |||
| 6-benzyl-3-propylaminocarbonyl-4-quinolone | Drug Info | [528134] | |||
| 6-bromo-3-ethoxycarbonyl-2-methyl-4-quinolone | Drug Info | [528134] | |||
| 6-bromo-3-ethoxycarbonyl-4-quinolone | Drug Info | [528134] | |||
| 6-ethyl-3-(2-ethylbutoxycarbonyl)-4-quinolone | Drug Info | [528134] | |||
| 6-ethyl-3-(2-methylbutoxycarbonyl)-4-quinolone | Drug Info | [528134] | |||
| 6-ethyl-3-(3-methylbutoxycarbonyl)-4-quinolone | Drug Info | [528134] | |||
| 6-ethyl-3-(3-pentoxycarbonyl)-4-quinolone | Drug Info | [528134] | |||
| 6-ethyl-3-i-propoxycarbonyl-4-quinolone | Drug Info | [528134] | |||
| 6-ethyl-3-pentoxycarbonyl-4-quinolone | Drug Info | [528134] | |||
| 6-ethyl-3-propoxycarbonyl-4-quinolone | Drug Info | [528134] | |||
| 6-ethyl-3-propylaminocarbonyl-4-quinolone | Drug Info | [528134] | |||
| 6-Methyl-2-oxa-spiro[4.4]nonan-1-one | Drug Info | [533975] | |||
| ALLOPREGNANOLONE | Drug Info | [527511] | |||
| AMENTOFLAVONE | Drug Info | [526653] | |||
| BETA-CCM | Drug Info | [533745] | |||
| CGS-13767 | Drug Info | [529466] | |||
| CGS-8216 | Drug Info | [525941] | |||
| CGS-9896 | Drug Info | [528080] | |||
| CI-218872 | Drug Info | [533745] | |||
| ELTANOLONE | Drug Info | [527511] | |||
| GAMMA-AMINO-BUTANOIC ACID | Drug Info | [528408] | |||
| GNF-PF-3645 | Drug Info | [528134] | |||
| GNF-PF-4421 | Drug Info | [528134] | |||
| N-(p-methylbenzyl)-5-nitroindol-3-ylglyoxylamide | Drug Info | [528709] | |||
| N-Benzyl-2-(1H-indol-3-yl)-2-oxo-acetamide | Drug Info | [528709] | |||
| N-benzyl-2-(5-nitro-1H-indol-3-yl)-2-oxoacetamide | Drug Info | [528709] | |||
| N-butyl-2-(1H-indol-3-yl)-2-oxoacetamide | Drug Info | [528709] | |||
| N-butyl-2-(5-nitro-1H-indol-3-yl)-2-oxoacetamide | Drug Info | [528709] | |||
| N-Indan-1-yl-2-(1H-indol-3-yl)-2-oxo-acetamide | Drug Info | [526094] | |||
| Ridine-5-carboxylic acid ethyl ester | Drug Info | [533164] | |||
| RO-145974 | Drug Info | [534008] | |||
| RO-145975 | Drug Info | [534008] | |||
| RO-147437 | Drug Info | [534008] | |||
| Ro-151310 | Drug Info | [534008] | |||
| Ro-154513 | Drug Info | [534008] | |||
| RO-194603 | Drug Info | [534008] | |||
| THIOCOLCHICOSIDE | Drug Info | [528408] | |||
| U-78875 | Drug Info | [534271] | |||
| U-89267 | Drug Info | [533912] | |||
| ZK-93423 | Drug Info | [530319] | |||
| Antagonist | Ethchlorvynol | Drug Info | [536555] | ||
| Blocker (channel blocker) | TBPS | Drug Info | [543812] | ||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Neuroactive ligand-receptor interaction | ||||
| Retrograde endocannabinoid signaling | |||||
| Serotonergic synapse | |||||
| GABAergic synapse | |||||
| Morphine addiction | |||||
| Nicotine addiction | |||||
| Reactome | Ligand-gated ion channel transport | ||||
| GABA A receptor activation | |||||
| WikiPathways | Neurotransmitter Receptor Binding And Downstream Transmission In The Postsynaptic Cell | ||||
| Iron uptake and transport | |||||
| References | |||||
| Ref 467451 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4108). | ||||
| Ref 467683 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4346). | ||||
| Ref 524035 | ClinicalTrials.gov (NCT01673828) Allopregnanolone for the Treatment of Traumatic Brain Injury. U.S. National Institutes of Health. | ||||
| Ref 533661 | Abecarnil enhances GABA-induced currents in acutely isolated cerebellar Purkinje cells. Neuropharmacology. 1995 Feb;34(2):157-63. | ||||
| Ref 538355 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 084463. | ||||
| Ref 542191 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7180). | ||||
| Ref 544687 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000585) | ||||
| Ref 544810 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001194) | ||||
| Ref 525941 | Bioorg Med Chem Lett. 2000 Dec 18;10(24):2723-6.Substituted 3-(2-benzoxazyl)-benzimidazol-2-(1H)-ones: a new class of GABA(A) brain receptor ligands. | ||||
| Ref 526094 | J Med Chem. 2001 Jul 5;44(14):2286-97.Novel N-(arylalkyl)indol-3-ylglyoxylylamides targeted as ligands of the benzodiazepine receptor: synthesis, biological evaluation, and molecular modeling analysis of the structure-activity relationships. | ||||
| Ref 526653 | Bioorg Med Chem Lett. 2003 Jul 21;13(14):2281-4.Semisynthetic preparation of amentoflavone: A negative modulator at GABA(A) receptors. | ||||
| Ref 527382 | J Med Chem. 2005 Jan 27;48(2):427-39.Potent 4-aryl- or 4-arylalkyl-substituted 3-isoxazolol GABA(A) antagonists: synthesis, pharmacology, and molecular modeling. | ||||
| Ref 527511 | J Med Chem. 2005 Apr 21;48(8):3051-9.Neurosteroid analogues. 10. The effect of methyl group substitution at the C-6 and C-7 positions on the GABA modulatory and anesthetic actions of (3alpha,5alpha)-and (3alpha,5beta)-3-hydroxypregnan-20-one. | ||||
| Ref 528080 | J Med Chem. 2006 Mar 23;49(6):1855-66.Synthesis, pharmacology, and structure-activity relationships of novel imidazolones and pyrrolones as modulators of GABAA receptors. | ||||
| Ref 528134 | J Med Chem. 2006 Apr 20;49(8):2526-33.4-quinolone derivatives: high-affinity ligands at the benzodiazepine site of brain GABA A receptors. synthesis, pharmacology, and pharmacophore modeling. | ||||
| Ref 528295 | J Med Chem. 2006 Jul 13;49(14):4442-6.Hydroxy-1,2,5-oxadiazolyl moiety as bioisoster of the carboxy function. Synthesis, ionization constants, and pharmacological characterization of gamma-aminobutyric acid (GABA) related compounds. | ||||
| Ref 528408 | J Med Chem. 2006 Sep 7;49(18):5571-7.3-demethoxy-3-glycosylaminothiocolchicines: Synthesis of a new class of putative muscle relaxant compounds. | ||||
| Ref 528709 | J Med Chem. 2007 Apr 5;50(7):1627-34. Epub 2007 Mar 3.Novel N-substituted indol-3-ylglyoxylamides probing the LDi and L1/L2 lipophilic regions of the benzodiazepine receptor site in search for subtype-selective ligands. | ||||
| Ref 529466 | J Med Chem. 1991 Jan;34(1):281-90.Synthesis and benzodiazepine binding activity of a series of novel [1,2,4]triazolo[1,5-c]quinazolin-5(6H)-ones. | ||||
| Ref 530319 | J Med Chem. 1990 Mar;33(3):1062-9.Structural requirements for agonist actions at the benzodiazepine receptor: studies with analogues of 6-(benzyloxy)-4-(methoxymethyl)-beta-carboline-3-carboxylic acid ethyl ester. | ||||
| Ref 530818 | J Med Chem. 2010 Apr 22;53(8):3417-21.Novel 4-(piperidin-4-yl)-1-hydroxypyrazoles as gamma-aminobutyric acid(A) receptor ligands: synthesis, pharmacology, and structure-activity relationships. | ||||
| Ref 531518 | J Med Chem. 1990 Sep;33(9):2343-57.Synthetic and computer-assisted analyses of the pharmacophore for the benzodiazepine receptor inverse agonist site. | ||||
| Ref 533033 | J Med Chem. 1989 May;32(5):1020-4.Benzodiazepine receptor binding activity of 6,9-disubstituted purines. | ||||
| Ref 533164 | J Med Chem. 1989 Dec;32(12):2561-73.Synthesis and structure-activity relationships of a series of anxioselective pyrazolopyridine ester and amide anxiolytic agents. | ||||
| Ref 533514 | J Med Chem. 1981 Dec;24(12):1377-83.gamma-Aminobutyric acid agonists, antagonists, and uptake inhibitors. Design and therapeutic aspects. | ||||
| Ref 533745 | J Med Chem. 1994 Dec 23;37(26):4576-80.Four amino acid exchanges convert a diazepam-insensitive, inverse agonist-preferring GABAA receptor into a diazepam-preferring GABAA receptor. | ||||
| Ref 533912 | J Med Chem. 1994 Mar 18;37(6):758-68.Antagonist, partial agonist, and full agonist imidazo[1,5-a]quinoxaline amides and carbamates acting through the GABAA/benzodiazepine receptor. | ||||
| Ref 533975 | J Med Chem. 1994 Jan 21;37(2):275-86.Alpha-spirocyclopentyl- and alpha-spirocyclopropyl-gamma-butyrolactones: conformationally constrained derivatives of anticonvulsant and convulsant alpha,alpha-disubstituted gamma-butyrolactones. | ||||
| Ref 534008 | J Med Chem. 1993 Apr 16;36(8):1001-6.Synthesis and evaluation of imidazo[1,5-a][1,4]benzodiazepine esters with high affinities and selectivities at "diazepam-insensitive" benzodiazepine receptors. | ||||
| Ref 534155 | J Med Chem. 1996 Jul 5;39(14):2844-51.Synthesis and structure--activity relationships of fused imidazopyridines: a new series of benzodiazepine receptor ligands. | ||||
| Ref 534271 | J Med Chem. 1996 Nov 8;39(23):4654-66.High-affinity alpha-aminobutyric acid A/benzodiazepine ligands: synthesis and structure-activity relationship studies of a new series of tetracyclic imidazoquinoxalines. | ||||
