Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T42000
|
||||
| Former ID |
TTDS00447
|
||||
| Target Name |
Interleukin-1 beta
|
||||
| Gene Name |
IL1B
|
||||
| Synonyms |
Catabolin; IL-1 beta; IL-1beta; IL1B
|
||||
| Target Type |
Successful
|
||||
| Disease | Alzheimer disease [ICD9: 331; ICD10: G30] | ||||
| Arthritis [ICD9: 710-719; ICD10: M00-M25] | |||||
| Acute gout flare [ICD9: 274; ICD10: M10] | |||||
| Cryopyrin-associated periodic syndromes; Rheumatoid arthritis [ICD9:277.31, 322.2, 339.8, 708.2, 708.8, 714.3, 710-719, 714; ICD10: E85.0, G03.1, G44.8, L50.2, L50.8, M08.9, M05-M06] | |||||
| Cardiovascular disorder [ICD10: I00-I99] | |||||
| Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
| Hypercalcemia [ICD9: 275.42; ICD10: E83.5] | |||||
| Immune disorder [ICD10: D80-D89] | |||||
| Inflammatory disease [ICD9: 140-229, 147, 173, 573.3, 710-719; ICD10: C11, C44, K75.9, M00-M25] | |||||
| Motor neurone disease; Amyotropic lateral sclerosis [ICD9: 335.2; ICD10: G12.2] | |||||
| Osteoarthritis [ICD9: 715; ICD10: M15-M19, M47] | |||||
| Opioid-related disorders; Diabetic neuropathy [ICD9: 250, 250.6, 292, 304.0, 305.50, 356.0, 356.8; ICD10: E08-E13, E10.4, E11.4, E13.4, F11, G64, G90.0] | |||||
| Type 2 diabetes [ICD9: 250; ICD10: E11] | |||||
| Urticaria; Vasculitis [ICD9: 446, 447.6, 708; ICD10: I77.6, I80, L50, L95, M30-M31] | |||||
| Function |
Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
|
||||
| BioChemical Class |
Cytokine: interleukin
|
||||
| Target Validation |
T42000
|
||||
| UniProt ID | |||||
| Sequence |
MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKG
FRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVR SLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKE KNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYIST SQAENMPVFLGGTKGGQDITDFTMQFVSS |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Canakinumab | Drug Info | Approved | Cryopyrin-associated periodic syndromes; Rheumatoid arthritis | [530677], [541853] |
| Gallium nitrate | Drug Info | Approved | Hypercalcemia | [550703] | |
| Glucosamine | Drug Info | Approved | Osteoarthritis | [467771], [550735] | |
| Rilonacept | Drug Info | Approved | Arthritis | [529941], [541871] | |
| Diacerein | Drug Info | Phase 4 | Discovery agent | [522329] | |
| Rilonacept | Drug Info | Phase 3 | Acute gout flare | [537207], [541871] | |
| XOMA 052 | Drug Info | Phase 3 | Type 2 diabetes | [524947] | |
| ABT-981 | Drug Info | Phase 2 | Osteoarthritis | [889392], [889410] | |
| Canakinumab | Drug Info | Phase 2 | Urticaria; Vasculitis | [530677], [541853] | |
| Ibudilast | Drug Info | Phase 2 | Opioid-related disorders; Diabetic neuropathy | [536374], [542420] | |
| LY-2189102 | Drug Info | Phase 2 | Cardiovascular disorder | [522731] | |
| CYT-013-IL1bQb | Drug Info | Phase 1 | Inflammatory disease | [522699] | |
| TT-301 | Drug Info | Phase 1 | Alzheimer disease | [523488] | |
| Celastrol | Drug Info | Preclinical | Motor neurone disease; Amyotropic lateral sclerosis | [536447] | |
| CDP-484 | Drug Info | Discontinued in Phase 1/2 | Immune disorder | [547485] | |
| Modulator | ABT-981 | Drug Info | [533176] | ||
| DVD-Ig | Drug Info | [543665] | |||
| Rilonacept | Drug Info | [529941] | |||
| Inhibitor | CDP-484 | Drug Info | [544084] | ||
| Diacerein | Drug Info | [537112] | |||
| Gallium nitrate | Drug Info | [536132] | |||
| Glucosamine | Drug Info | [537627] | |||
| Ibudilast | Drug Info | [536374] | |||
| TT-301 | Drug Info | [544205] | |||
| Suppressor | Celastrol | Drug Info | [536447] | ||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | MAPK signaling pathway | ||||
| Cytokine-cytokine receptor interaction | |||||
| NF-kappa B signaling pathway | |||||
| Apoptosis | |||||
| Osteoclast differentiation | |||||
| Toll-like receptor signaling pathway | |||||
| NOD-like receptor signaling pathway | |||||
| Cytosolic DNA-sensing pathway | |||||
| Hematopoietic cell lineage | |||||
| TNF signaling pathway | |||||
| Inflammatory mediator regulation of TRP channels | |||||
| Non-alcoholic fatty liver disease (NAFLD) | |||||
| Type I diabetes mellitus | |||||
| Alzheimer' | |||||
| s disease | |||||
| Prion diseases | |||||
| Salmonella infection | |||||
| Pertussis | |||||
| Legionellosis | |||||
| Leishmaniasis | |||||
| Chagas disease (American trypanosomiasis) | |||||
| African trypanosomiasis | |||||
| Malaria | |||||
| Amoebiasis | |||||
| Tuberculosis | |||||
| Measles | |||||
| Influenza A | |||||
| Herpes simplex infection | |||||
| Inflammatory bowel disease (IBD) | |||||
| Rheumatoid arthritis | |||||
| Graft-versus-host disease | |||||
| NetPath Pathway | Leptin Signaling Pathway | ||||
| IL5 Signaling Pathway | |||||
| IL1 Signaling Pathway | |||||
| IL2 Signaling Pathway | |||||
| IL3 Signaling Pathway | |||||
| TGF_beta_Receptor Signaling Pathway | |||||
| Wnt Signaling Pathway | |||||
| TCR Signaling Pathway | |||||
| TNFalpha Signaling Pathway | |||||
| Pathway Interaction Database | IL27-mediated signaling events | ||||
| IL12-mediated signaling events | |||||
| IL1-mediated signaling events | |||||
| IFN-gamma pathway | |||||
| IL23-mediated signaling events | |||||
| Cellular roles of Anthrax toxin | |||||
| Reactome | Interleukin-1 signaling | ||||
| Interleukin-1 processing | |||||
| CLEC7A/inflammasome pathway | |||||
| WikiPathways | Toll-like receptor signaling pathway | ||||
| Monoamine Transport | |||||
| SIDS Susceptibility Pathways | |||||
| TCR Signaling Pathway | |||||
| Type II interferon signaling (IFNG) | |||||
| Senescence and Autophagy in Cancer | |||||
| Cytokines and Inflammatory Response | |||||
| MAPK Signaling Pathway | |||||
| Myometrial Relaxation and Contraction Pathways | |||||
| Aryl Hydrocarbon Receptor Pathway | |||||
| IL1 and megakaryotyces in obesity | |||||
| Hematopoietic Stem Cell Differentiation | |||||
| Spinal Cord Injury | |||||
| Allograft Rejection | |||||
| Alzheimers Disease | |||||
| Leptin signaling pathway | |||||
| IL-1 signaling pathway | |||||
| Interleukin-1 signaling | |||||
| Folate Metabolism | |||||
| Vitamin B12 Metabolism | |||||
| Selenium Micronutrient Network | |||||
| Serotonin Transporter Activity | |||||
| Regulation of toll-like receptor signaling pathway | |||||
| NOD pathway | |||||
| References | |||||
| Ref 467771 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4535). | ||||
| Ref 522329 | ClinicalTrials.gov (NCT00685542) Effect of Diacerein on Hand Osteoarthritis. U.S. National Institutes of Health. | ||||
| Ref 522699 | ClinicalTrials.gov (NCT00924105) Safety, Tolerability and Pharmacodynamics of CYT013-IL1bQb in Patients With Type 2 Diabetes. U.S. National Institutes of Health. | ||||
| Ref 522731 | ClinicalTrials.gov (NCT00942188) A Study of LY2189102 in Patients With Type 2 Diabetes. U.S. National Institutes of Health. | ||||
| Ref 523488 | ClinicalTrials.gov (NCT01357421) Effects of TT301 on Cytokine Levels Post Endotoxin Challenge. U.S. National Institutes of Health. | ||||
| Ref 524947 | ClinicalTrials.gov (NCT02258867) Efficacy and Safety Study of Gevokizumab to Treat Behcet's Disease Uveitis. U.S. National Institutes of Health. | ||||
| Ref 536447 | Emerging disease-modifying therapies for the treatment of motor neuron disease/amyotropic lateral sclerosis. Expert Opin Emerg Drugs. 2007 May;12(2):229-52. | ||||
| Ref 541853 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6773). | ||||
| Ref 541871 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6790). | ||||
| Ref 542420 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7399). | ||||
| Ref 547485 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800016757) | ||||
| Ref 531297 | Gevokizumab, an anti-IL-1beta mAb for the potential treatment of type 1 and 2 diabetes, rheumatoid arthritis and cardiovascular disease. Curr Opin Mol Ther. 2010 Dec;12(6):755-69. | ||||
| Ref 532275 | Double-blind, randomized study evaluating the glycemic and anti-inflammatory effects of subcutaneous LY2189102, a neutralizing IL-1beta antibody, in patients with type 2 diabetes. Diabetes Care. 2013Aug;36(8):2239-46. | ||||
| Ref 533176 | Generation and characterization of ABT-981, a dual variable domain immunoglobulin (DVD-Ig(TM)) molecule that specifically and potently neutralizes both IL-1alpha and IL-1beta. MAbs. 2015;7(3):605-19. | ||||
| Ref 536132 | Elimination of arthritis pain and inflammation for over 2 years with a single 90 min, topical 14% gallium nitrate treatment: case reports and review of actions of gallium III. Med Hypotheses. 2005;65(6):1136-41. Epub 2005 Aug 24. | ||||
| Ref 536447 | Emerging disease-modifying therapies for the treatment of motor neuron disease/amyotropic lateral sclerosis. Expert Opin Emerg Drugs. 2007 May;12(2):229-52. | ||||
| Ref 537112 | Non-surgical treatment of osteoarthritis of large joints - new aspects. Wien Med Wochenschr. 2009;159(3-4):76-86. | ||||
| Ref 537627 | Glucosamine inhibits IL-1beta-mediated IL-8 production in prostate cancer cells by MAPK attenuation. J Cell Biochem. 2009 Jul 22. | ||||
| Ref 543665 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2623). | ||||
