Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T98913
|
||||
| Former ID |
TTDS00411
|
||||
| Target Name |
Macrophage colony-stimulating factor receptor
|
||||
| Gene Name |
CSF3R
|
||||
| Synonyms |
CD115; CSF-1-R; CSF1R; FMS; Fms proto-oncogene; c-fms; GCSF receptor; CSF3R
|
||||
| Target Type |
Successful
|
||||
| Disease | Autoimmune diabetes [ICD10: E08-E13] | ||||
| Alzheimer disease [ICD9: 331; ICD10: G30] | |||||
| Bone cancer [ICD10: C41.0] | |||||
| Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
| Cardiovascular disorder [ICD10: I00-I99] | |||||
| Inflammatory disease [ICD9: 140-229, 147, 173, 573.3, 710-719; ICD10: C11, C44, K75.9, M00-M25] | |||||
| Leukemia [ICD9: 208.9; ICD10: C90-C95] | |||||
| Non-myeloid cancer [ICD9: 140-199; ICD10: C00-C75, C7A, C7B] | |||||
| Neutropenia [ICD9: 288; ICD10: D70] | |||||
| Pancreatic cancer [ICD9: 140-199, 140-229, 157, 210-229; ICD10: C25] | |||||
| Severe neutropaenia in non-myeloid malignancies [ICD9: 140-239; ICD10: C00-C96] | |||||
| Function |
Receptor for granulocyte colony-stimulating factor (CSF3), essential for granulocytic maturation. Plays a crucial role in the proliferation, differientation and survival of cells along the neutrophilic lineage. In addition it may function in some adhesion or recognition events at the cell surface.
|
||||
| BioChemical Class |
Type I cytokine receptor
|
||||
| Target Validation |
T98913
|
||||
| UniProt ID | |||||
| Sequence |
MARLGNCSLTWAALIILLLPGSLEECGHISVSAPIVHLGDPITASCIIKQNCSHLDPEPQ
ILWRLGAELQPGGRQQRLSDGTQESIITLPHLNHTQAFLSCCLNWGNSLQILDQVELRAG YPPAIPHNLSCLMNLTTSSLICQWEPGPETHLPTSFTLKSFKSRGNCQTQGDSILDCVPK DGQSHCCIPRKHLLLYQNMGIWVQAENALGTSMSPQLCLDPMDVVKLEPPMLRTMDPSPE AAPPQAGCLQLCWEPWQPGLHINQKCELRHKPQRGEASWALVGPLPLEALQYELCGLLPA TAYTLQIRCIRWPLPGHWSDWSPSLELRTTERAPTVRLDTWWRQRQLDPRTVQLFWKPVP LEEDSGRIQGYVVSWRPSGQAGAILPLCNTTELSCTFHLPSEAQEVALVAYNSAGTSRPT PVVFSESRGPALTRLHAMARDPHSLWVGWEPPNPWPQGYVIEWGLGPPSASNSNKTWRME QNGRATGFLLKENIRPFQLYEIIVTPLYQDTMGPSQHVYAYSQEMAPSHAPELHLKHIGK TWAQLEWVPEPPELGKSPLTHYTIFWTNAQNQSFSAILNASSRGFVLHGLEPASLYHIHL MAASQAGATNSTVLTLMTLTPEGSELHIILGLFGLLLLLTCLCGTAWLCCSPNRKNPLWP SVPDPAHSSLGSWVPTIMEEDAFQLPGLGTPPITKLTVLEEDEKKPVPWESHNSSETCGL PTLVQTYVLQGDPRAVSTQPQSQSGTSDQVLYGQLLGSPTSPGPGHYLRCDSTQPLLAGL TPSPKSYENLWFQASPLGTLVTPAPSQEDDCVFGPLLNFPLLQGIRVHGMEALGSF |
||||
| Structure |
1AZ7; 2D9Q
|
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Filgrastim | Drug Info | Approved | Neutropenia | [536361], [542000] |
| Filgrastim-SNDZ | Drug Info | Approved | Neutropenia | [551873] | |
| Pegfilgrastim | Drug Info | Approved | Non-myeloid cancer | [536361], [542001] | |
| Tbo-Filgrastim | Drug Info | Approved | Severe neutropaenia in non-myeloid malignancies | [532210] | |
| Peg-G-CSF | Drug Info | Phase 3 | Cancer | [524038] | |
| PLX-3397 | Drug Info | Phase 3 | Alzheimer disease | [525099] | |
| AX-200 | Drug Info | Phase 2 | Cardiovascular disorder | [521663] | |
| MAXY-G34 | Drug Info | Phase 2 | Neutropenia | [522065] | |
| SBC-014 | Drug Info | Phase 2 | Neutropenia | [522057] | |
| MK-6302 | Drug Info | Phase 1 | Neutropenia | [551956] | |
| PLX-5622 | Drug Info | Phase 1 | Autoimmune diabetes | [523330] | |
| PLX7486 | Drug Info | Phase 1 | Pancreatic cancer | [549504] | |
| ZD-6003 | Drug Info | Terminated | Cancer | [545575] | |
| Inhibitor | AC-710 | Drug Info | [543466] | ||
| AZD-7507 | Drug Info | [543466] | |||
| BLZ-945 | Drug Info | [543466] | |||
| N-(2-morpholinophenyl)-5-nitrofuran-2-carboxamide | Drug Info | [529071] | |||
| PLX-3397 | Drug Info | [550447] | |||
| PLX-5622 | Drug Info | [544233] | |||
| PLX7486 | Drug Info | [550497] | |||
| Modulator | AX-200 | Drug Info | [532461] | ||
| Filgrastim-SNDZ | Drug Info | [551871] | |||
| MK-6302 | Drug Info | [525376] | |||
| SBC-014 | Drug Info | [544066] | |||
| Tbo-Filgrastim | Drug Info | [532210] | |||
| ZD-6003 | Drug Info | [543466] | |||
| Binder | Filgrastim | Drug Info | [535943], [537204] | ||
| Pegfilgrastim | Drug Info | [535943] | |||
| Stimulator | G-CSF | Drug Info | [543466] | ||
| Peg-G-CSF | Drug Info | [543466] | |||
| ZP-G-CSF | Drug Info | [543466] | |||
| Agonist | MAXY-G34 | Drug Info | [532564] | ||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| References | |||||
| Ref 521663 | ClinicalTrials.gov (NCT00132470) Treatment With AX200 for Acute Ischemic Stroke. U.S. National Institutes of Health. | ||||
| Ref 522057 | ClinicalTrials.gov (NCT00497809) Safety and Efficacy Study of GCSF Therapy to Treat Patients at High Risk for Chemotherapy Induced Severe Neutropenia. U.S. National Institutes of Health. | ||||
| Ref 522065 | ClinicalTrials.gov (NCT00501332) Evaluation of Maxy-G34 in Breast Cancer Patients Treated With TAC (Docetaxel, Adriamycin, Cyclophosphamide) Chemotherapy. U.S. National Institutes of Health. | ||||
| Ref 523330 | ClinicalTrials.gov (NCT01282684) Study to Evaluate the Safety, Tolerability, and Pharmacokinetics of PLX5622 in Healthy Adult Volunteers. U.S. National Institutes of Health. | ||||
| Ref 524038 | ClinicalTrials.gov (NCT01674855) Phase III Study of DA-3031(PEG-G-CSF) in Chemotherapy-induced Neutropenia. U.S. National Institutes of Health. | ||||
| Ref 525099 | ClinicalTrials.gov (NCT02371369) PLX3397 Phase 3 Study for Pigmented Villonodular Synovitis (PVNS) or Giant Cell Tumor of the Tendon Sheath (GCT-TS). U.S. National Institutes of Health. | ||||
| Ref 536361 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20. | ||||
| Ref 542000 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6968). | ||||
| Ref 542001 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6969). | ||||
| Ref 545575 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003738) | ||||
| Ref 549504 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800038879) | ||||
| Ref 529071 | Bioorg Med Chem Lett. 2007 Nov 15;17(22):6070-4. Epub 2007 Sep 19.Potent 2'-aminoanilide inhibitors of cFMS as potential anti-inflammatory agents. | ||||
| Ref 532461 | Granulocyte colony-stimulating factor in patients with acute ischemic stroke: results of the AX200 for Ischemic Stroke trial. Stroke. 2013 Oct;44(10):2681-7. | ||||
| Ref 532564 | Survival efficacy of the PEGylated G-CSFs Maxy-G34 and neulasta in a mouse model of lethal H-ARS, and residual bone marrow damage in treated survivors. Health Phys. 2014 Jan;106(1):21-38. | ||||
| Ref 535943 | Evidence that the granulocyte colony-stimulating factor (G-CSF) receptor plays a role in the pharmacokinetics of G-CSF and PegG-CSF using a G-CSF-R KO model. Pharmacol Res. 2004 Jul;50(1):55-8. | ||||
| Ref 537204 | XM02, the first granulocyte colony-stimulating factor biosimilar, is safe and effective in reducing the duration of severe neutropenia and incidence of febrile neutropenia in patients with non-Hodgkin lymphoma receiving chemotherapy. Leuk Lymphoma. 2009 Mar;50(3):374-9. | ||||
| Ref 543466 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1719). | ||||
| Ref 544066 | A glycosylated recombinant human granulocyte colony stimulating factor produced in a novel protein production system (AVI-014) in healthy subjects: a first-in human, single dose, controlled study. BMC Clin Pharmacol. 2009; 9: 2. | ||||
