Target General Infomation
Target ID
T23172
Former ID
TTDC00084
Target Name
Tyrosine-protein kinase JAK3
Gene Name
JAK3
Synonyms
JAK-3; Janus kinase 3; L-JAK; Leukocyte janus kinase; JAK3
Target Type
Successful
Disease Autoimmune diabetes [ICD10: E08-E13]
Inflammatory disease [ICD9: 140-229, 147, 173, 573.3, 710-719; ICD10: C11, C44, K75.9, M00-M25]
Psoriasis [ICD9: 696; ICD10: L40]
Rheumatoid arthritis [ICD9: 710-719, 714; ICD10: M05-M06]
Renal transplantation [ICD9: 279.5; ICD10: D89.8]
Renal transplantation; Multiple myeloma [ICD9:279.5, 203; ICD10: D89.8, C90]
Function
Non-receptor tyrosine kinase involved in various processes such as cell growth, development, or differentiation. Mediates essential signaling events in both innate and adaptive immunity and plays a crucial role in hematopoiesis during T-cells development. In the cytoplasm, plays a pivotal role in signal transduction via its association with type I receptors sharing the common subunit gamma such as IL2R, IL4R, IL7R,IL9R, IL15R and IL21R. Following ligand binding to cell surface receptors, phosphorylates specific tyrosine residues on the cytoplasmic tails of the receptor, creating docking sites for STATs proteins. Subsequently, phosphorylates the STATs proteins once they are recruited to the receptor. Phosphorylated STATs then form homodimer or heterodimers and translocate to the nucleus to activate gene transcription. For example, upon IL2R activation by IL2, JAK1 and JAK3 molecules bind to IL2R beta (IL2RB) and gamma chain (IL2RG) subunits inducing the tyrosine phosphorylation of both receptor subunitson their cytoplasmic domain. Then, STAT5A AND STAT5B are recruited, phosphorylated and activated by JAK1 and JAK3. Once activated, dimerized STAT5 translocates to the nucleus and promotes the transcription of specific target genes in a cytokine-specific fashion.
BioChemical Class
Kinase
Target Validation
T23172
UniProt ID
EC Number
EC 2.7.10.2
Sequence
MAPPSEETPLIPQRSCSLLSTEAGALHVLLPARGPGPPQRLSFSFGDHLAEDLCVQAAKA
SGILPVYHSLFALATEDLSCWFPPSHIFSVEDASTQVLLYRIRFYFPNWFGLEKCHRFGL
RKDLASAILDLPVLEHLFAQHRSDLVSGRLPVGLSLKEQGECLSLAVLDLARMAREQAQR
PGELLKTVSYKACLPPSLRDLIQGLSFVTRRRIRRTVRRALRRVAACQADRHSLMAKYIM
DLERLDPAGAAETFHVGLPGALGGHDGLGLLRVAGDGGIAWTQGEQEVLQPFCDFPEIVD
ISIKQAPRVGPAGEHRLVTVTRTDNQILEAEFPGLPEALSFVALVDGYFRLTTDSQHFFC
KEVAPPRLLEEVAEQCHGPITLDFAINKLKTGGSRPGSYVLRRSPQDFDSFLLTVCVQNP
LGPDYKGCLIRRSPTGTFLLVGLSRPHSSLRELLATCWDGGLHVDGVAVTLTSCCIPRPK
EKSNLIVVQRGHSPPTSSLVQPQSQYQLSQMTFHKIPADSLEWHENLGHGSFTKIYRGCR
HEVVDGEARKTEVLLKVMDAKHKNCMESFLEAASLMSQVSYRHLVLLHGVCMAGDSTMVQ
EFVHLGAIDMYLRKRGHLVPASWKLQVVKQLAYALNYLEDKGLPHGNVSARKVLLAREGA
DGSPPFIKLSDPGVSPAVLSLEMLTDRIPWVAPECLREAQTLSLEADKWGFGATVWEVFS
GVTMPISALDPAKKLQFYEDRQQLPAPKWTELALLIQQCMAYEPVQRPSFRAVIRDLNSL
ISSDYELLSDPTPGALAPRDGLWNGAQLYACQDPTIFEERHLKYISQLGKGNFGSVELCR
YDPLGDNTGALVAVKQLQHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYGPGRQSLRL
VMEYLPSGCLRDFLQRHRARLDASRLLLYSSQICKGMEYLGSRRCVHRDLAARNILVESE
AHVKIADFGLAKLLPLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYEL
FTYCDKSCSPSAEFLRMMGCERDVPALCRLLELLEEGQRLPAPPACPAEVHELMKLCWAP
SPQDRPSFSALGPQLDMLWSGSRGCETHAFTAHPEGKHHSLSFS
Structure
1YVJ; 3LXK; 3LXL; 3PJC; 3ZC6; 3ZEP; 4HVD; 4HVG; 4HVH; 4HVI; 4I6Q; 4QPS; 4RIO
Drugs and Mode of Action
Drug(s) Tofacitinib Drug Info Approved Rheumatoid arthritis [524789], [541020], [551871]
ASP-015K Drug Info Phase 3 Psoriasis [525016], [543066]
VX-509 Drug Info Phase 2/3 Rheumatoid arthritis [524261], [543061]
AG490 Drug Info Terminated Renal transplantation; Multiple myeloma [541206], [546151]
PNU156804 Drug Info Terminated Renal transplantation [546472]
R348 Drug Info Terminated Psoriasis [537117]
Inhibitor 6-o-tolylquinazolin-2-amine Drug Info [528429]
AD-412 Drug Info [543546]
AG490 Drug Info [536279]
ASP-015K Drug Info [543546]
Atropisomer 1 Drug Info [530583]
CMP-6 Drug Info [526307]
compound 19a Drug Info [532598]
compound 1d Drug Info [531435]
compound 2 Drug Info [527295]
NC1153 Drug Info [536279]
PF-956980 Drug Info [543546]
PNU156804 Drug Info [535337]
R348 Drug Info [537117]
VX-467 Drug Info [543546]
VX-509 Drug Info [532777], [533175]
WHI-P154 Drug Info [529228]
ZM-39923 Drug Info [525732]
Modulator Tofacitinib Drug Info [551871]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
KEGG Pathway Chemokine signaling pathway
PI3K-Akt signaling pathway
Signaling pathways regulating pluripotency of stem cells
Jak-STAT signaling pathway
Measles
HTLV-I infection
Epstein-Barr virus infection
Viral carcinogenesis
Primary immunodeficiency
PANTHER Pathway Interleukin signaling pathway
JAK/STAT signaling pathway
PDGF signaling pathway
Pathway Interaction Database IL4-mediated signaling events
CD40/CD40L signaling
Signaling events mediated by TCPTP
SHP2 signaling
IL2-mediated signaling events
IL2 signaling events mediated by PI3K
IL2 signaling events mediated by STAT5
Reactome GPVI-mediated activation cascade
Interleukin-7 signaling
gamma signalling through PI3Kgamma
Interleukin-2 signaling
RAF/MAP kinase cascade
Interleukin receptor SHC signaling
WikiPathways IL-2 Signaling Pathway
IL-4 Signaling Pathway
Interleukin-2 signaling
Interleukin-7 signaling
Oncostatin M Signaling Pathway
IL-9 Signaling Pathway
IL-7 Signaling Pathway
Interleukin-3, 5 and GM-CSF signaling
References
Ref 524261ClinicalTrials.gov (NCT01830985) A Phase 2/3 Open-label Extension Study to Evaluate Long-Term Safety and Efficacy With VX-509 in Subjects With Rheumatoid Arthritis. U.S. National Institutes of Health.
Ref 524789ClinicalTrials.gov (NCT02157012) Evaluation of the Condition of Rheumatoid Arthritis After Treatment. U.S. National Institutes of Health.
Ref 525016ClinicalTrials.gov (NCT02308163) A Study to Evaluate Safety and Efficacy of ASP015K in Patients With Rheumatoid Arthritis (RA) Who Had an Inadequate Response to DMARDs. U.S. National Institutes of Health.
Ref 537117Emerging drugs for psoriasis. Expert Opin Emerg Drugs. 2009 Mar;14(1):145-63.
Ref 541020(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5677).
Ref 541206(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5916).
Ref 543061(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8309).
Ref 543066(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8315).
Ref 546151Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006610)
Ref 546472Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008393)
Ref 551871Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
Ref 525732Naphthyl ketones: a new class of Janus kinase 3 inhibitors. Bioorg Med Chem Lett. 2000 Mar 20;10(6):575-9.
Ref 526307Photochemical preparation of a pyridone containing tetracycle: a Jak protein kinase inhibitor. Bioorg Med Chem Lett. 2002 Apr 22;12(8):1219-23.
Ref 527295Discovery of novel 2-(aminoheteroaryl)-thiazole-5-carboxamides as potent and orally active Src-family kinase p56(Lck) inhibitors. Bioorg Med Chem Lett. 2004 Dec 20;14(24):6061-6.
Ref 528429J Med Chem. 2006 Sep 21;49(19):5671-86.Discovery of aminoquinazolines as potent, orally bioavailable inhibitors of Lck: synthesis, SAR, and in vivo anti-inflammatory activity.
Ref 529228The specificity of JAK3 kinase inhibitors. Blood. 2008 Feb 15;111(4):2155-7. Epub 2007 Dec 19.
Ref 530583J Med Chem. 2009 Dec 24;52(24):7938-41.Janus kinase 2 inhibitors. Synthesis and characterization of a novel polycyclic azaindole.
Ref 531435In vitro and in vivo evaluation of 6-aminopyrazolyl-pyridine-3-carbonitriles as JAK2 kinase inhibitors. Bioorg Med Chem Lett. 2011 May 15;21(10):2958-61.
Ref 532598Discovery of 1-methyl-1H-imidazole derivatives as potent Jak2 inhibitors. J Med Chem. 2014 Jan 9;57(1):144-58.
Ref 532777Selective JAK inhibitors in development for rheumatoid arthritis. Expert Opin Investig Drugs. 2014 Aug;23(8):1067-77.
Ref 533175VX-509 (decernotinib) is a potent and selective janus kinase 3 inhibitor that attenuates inflammation in animal models of autoimmune disease. J Pharmacol Exp Ther. 2015 May;353(2):405-14.
Ref 535337Selective inhibitor of Janus tyrosine kinase 3, PNU156804, prolongs allograft survival and acts synergistically with cyclosporine but additively with rapamycin. Blood. 2002 Jan 15;99(2):680-9.
Ref 536279Immunotherapy for De Novo renal transplantation: what's in the pipeline? Drugs. 2006;66(13):1665-84.
Ref 537117Emerging drugs for psoriasis. Expert Opin Emerg Drugs. 2009 Mar;14(1):145-63.
Ref 543546(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2049).
Ref 551871Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015