Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T52790
|
||||
| Former ID |
TTDC00090
|
||||
| Target Name |
NK-2 receptor
|
||||
| Gene Name |
TACR2
|
||||
| Synonyms |
NK-2 receptor; NK-2R; Neurokinin A receptor; SKR; Tachykinin neurokinin 2 receptor; Tachykinin receptor 2; TACR2
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Asthma [ICD10: J45] | ||||
| Anxiety disorder [ICD9: 300, 311; ICD10: F32, F40-F42] | |||||
| Chronic obstructive pulmonary disease [ICD9: 490-492, 494-496; ICD10: J40-J44, J47] | |||||
| Depression; Anxiety [ICD9: 300, 311; ICD10: F30-F39, F40-F42] | |||||
| Depression; Acute or chronic pain; Anxiety disorders; Urinary incontinence [ICD9: 300, 311, 338, 338.2, 787.6, 788.3,780; ICD10: F30-F42, N39.3-N39.4, G89] | |||||
| Infantile colics; Postoperative ileus [ICD9: 537.2, 560.1, 560.31, 777.1, 777.4, 789.7; ICD10: K31.5, K56.0, K56.3, K56.7, P76.1, R10.4] | |||||
| Irritable bowel syndrome [ICD9: 564.1, 787.91; ICD10: A09, K58, K59.1] | |||||
| Irritable bowel syndrome with diarrhoea [ICD9: 493, 564.1, 787.91; ICD10: A09, J45, K58, K59.1] | |||||
| Pain [ICD9: 338, 356.0, 356.8,780; ICD10: G64, G90.0, R52, G89] | |||||
| Urinary incontinence [ICD9: 788.3; ICD10: N39.3, N39.4, R32] | |||||
| Unspecified [ICD code not available] | |||||
| Function |
This is a receptor for the tachykinin neuropeptide substance K (neurokinin A). It is associated with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of affinity of this receptor to tachykinins is: substance K > neuromedin-K > substance P.
|
||||
| BioChemical Class |
GPCR rhodopsin
|
||||
| Target Validation |
T52790
|
||||
| UniProt ID | |||||
| Sequence |
MGTCDIVTEANISSGPESNTTGITAFSMPSWQLALWATAYLALVLVAVTGNAIVIWIILA
HRRMRTVTNYFIVNLALADLCMAAFNAAFNFVYASHNIWYFGRAFCYFQNLFPITAMFVS IYSMTAIAADRYMAIVHPFQPRLSAPSTKAVIAGIWLVALALASPQCFYSTVTMDQGATK CVVAWPEDSGGKTLLLYHLVVIALIYFLPLAVMFVAYSVIGLTLWRRAVPGHQAHGANLR HLQAMKKFVKTMVLVVLTFAICWLPYHLYFILGSFQEDIYCHKFIQQVYLALFWLAMSST MYNPIIYCCLNHRFRSGFRLAFRCCPWVTPTKEDKLELTPTTSLSTRVNRCHTKETLFMA GDTAPSEATSGEAGRPQDGSGLWFGYGLLAPTKTHVEI |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Ibodutant | Drug Info | Phase 3 | Irritable bowel syndrome | [525030], [539341] |
| Nepadutant | Drug Info | Phase 1/2 | Infantile colics; Postoperative ileus | [536527], [539347] | |
| SLV-332 | Drug Info | Preclinical | Irritable bowel syndrome | [536224] | |
| Saredutant | Drug Info | Discontinued in Phase 3 | Depression; Anxiety | [536580], [539338] | |
| CS-003 | Drug Info | Discontinued in Phase 2 | Chronic obstructive pulmonary disease | [536223] | |
| DNK-333 | Drug Info | Discontinued in Phase 2 | Irritable bowel syndrome with diarrhoea | [536223] | |
| FK-224 | Drug Info | Discontinued in Phase 2 | Asthma | [539332], [544903] | |
| AVE-5883 | Drug Info | Discontinued in Phase 1/2 | Asthma | [548050] | |
| SR 144190 | Drug Info | Discontinued in Phase 1 | Depression; Acute or chronic pain; Anxiety disorders; Urinary incontinence | [546499] | |
| UK-224671 | Drug Info | Discontinued in Phase 1 | Urinary incontinence | [546880] | |
| AZD-5106 | Drug Info | Terminated | Urinary incontinence | [547343] | |
| GR-159897 | Drug Info | Terminated | Anxiety disorder | [539340], [545424] | |
| L-732138 | Drug Info | Terminated | Discovery agent | [546118] | |
| MEN-10207 | Drug Info | Terminated | Pain | [545551] | |
| MEN-10627 | Drug Info | Terminated | Asthma | [540539], [545837] | |
| UK-290795 | Drug Info | Terminated | Urinary incontinence | [547543] | |
| ZD-7944 | Drug Info | Terminated | Asthma | [546304] | |
| Inhibitor | 4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one | Drug Info | [531079] | ||
| A-987306 | Drug Info | [529789] | |||
| Ac-Phe-[Orn-Pro-cha-Trp-Arg] | Drug Info | [528343] | |||
| Hoo-Phe-Orn-Pro-hle-Pff-Phe-NH2 | Drug Info | [528343] | |||
| L-732138 | Drug Info | [531023] | |||
| WAY-207024 | Drug Info | [530005] | |||
| Modulator | AVE-5883 | Drug Info | [528579] | ||
| DNK-333 | Drug Info | ||||
| FK-224 | Drug Info | [526798] | |||
| GR-159897 | Drug Info | [533707] | |||
| MEN-10207 | Drug Info | [528181] | |||
| MEN-10627 | Drug Info | [533842] | |||
| ZD-6021 | Drug Info | ||||
| ZD-7944 | Drug Info | [526161] | |||
| Antagonist | AZD-5106 | Drug Info | [547344] | ||
| CS-003 | Drug Info | [536223] | |||
| GR100679 | Drug Info | [533929] | |||
| GR94800 | Drug Info | [533855] | |||
| Ibodutant | Drug Info | [532668] | |||
| MEN13510 | Drug Info | [536088] | |||
| Nepadutant | Drug Info | [536527] | |||
| R396 | Drug Info | [533690] | |||
| Saredutant | Drug Info | [536765], [537079], [537293] | |||
| SCH 206272 | Drug Info | [526412] | |||
| SLV-332 | Drug Info | [536224] | |||
| SR 144190 | Drug Info | [535777], [535994] | |||
| UK-224671 | Drug Info | [525841] | |||
| UK-290795 | Drug Info | [547544] | |||
| YM44778 | Drug Info | [526310] | |||
| YM44781 | Drug Info | [526310] | |||
| YM49598 | Drug Info | [526310] | |||
| ZM 253270 | Drug Info | [533637] | |||
| ZM-274773 | Drug Info | [531732] | |||
| [3H]saredutant | Drug Info | [533710] | |||
| Agonist | neurokinin A | Drug Info | [525944] | ||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| References | |||||
| Ref 525030 | ClinicalTrials.gov (NCT02320318) 12-Week Efficacy and Safety Study of Ibodutant in Women With Irritable Bowel Syndrome With Diarrhea (IBS-D). U.S. National Institutes of Health. | ||||
| Ref 536223 | Emerging drugs for the treatment of chronic obstructive pulmonary disease. Expert Opin Emerg Drugs. 2006 May;11(2):275-91. | ||||
| Ref 536224 | Emerging drugs for irritable bowel syndrome. Expert Opin Emerg Drugs. 2006 May;11(2):293-313. | ||||
| Ref 536580 | Novel drugs and therapeutic targets for severe mood disorders. Neuropsychopharmacology. 2008 Aug;33(9):2080-92. Epub 2008 Jan 2. | ||||
| Ref 539332 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2103). | ||||
| Ref 539338 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2111). | ||||
| Ref 539340 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2115). | ||||
| Ref 539341 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2117). | ||||
| Ref 539347 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2123). | ||||
| Ref 540539 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3901). | ||||
| Ref 544903 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001455) | ||||
| Ref 545424 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003215) | ||||
| Ref 545551 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003687) | ||||
| Ref 545837 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004991) | ||||
| Ref 546118 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006439) | ||||
| Ref 546304 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007349) | ||||
| Ref 546499 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008589) | ||||
| Ref 546880 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010850) | ||||
| Ref 547343 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800015341) | ||||
| Ref 525841 | Pharmacokinetics and metabolism of a sulphamide NK2 antagonist in rat, dog and human. Xenobiotica. 2000 Jun;30(6):627-42. | ||||
| Ref 525944 | Structure-activity relationships of neurokinin A (4-10) at the human tachykinin NK(2) receptor: the role of natural residues and their chirality. Biochem Pharmacol. 2001 Jan 1;61(1):55-60. | ||||
| Ref 526161 | Discovery of novel, orally active dual NK1/NK2 antagonists. Bioorg Med Chem Lett. 2001 Oct 22;11(20):2769-73. | ||||
| Ref 526310 | Effect of YM-44781, YM-44778 and YM-49598, novel tachykinin antagonists, in a drug-induced bladder contraction model. Pharmacology. 2002 May;65(2):96-102. | ||||
| Ref 526412 | SCH 206272: a potent, orally active tachykinin NK(1), NK(2), and NK(3) receptor antagonist. Eur J Pharmacol. 2002 Aug 23;450(2):191-202. | ||||
| Ref 526798 | FK 224, a novel cyclopeptide substance P antagonist with NK1 and NK2 receptor selectivity. J Pharmacol Exp Ther. 1992 Jul;262(1):398-402. | ||||
| Ref 528181 | Role of D-tryptophan for affinity of MEN 10207 tachykinin antagonist at NK2 receptors. Peptides. 1991 Sep-Oct;12(5):1015-8. | ||||
| Ref 528343 | Bioorg Med Chem Lett. 2006 Oct 1;16(19):5088-92. Epub 2006 Jul 28.Peptidomimetic C5a receptor antagonists with hydrophobic substitutions at the C-terminus: increased receptor specificity and in vivoactivity. | ||||
| Ref 528579 | Effect of an NK1/NK2 receptor antagonist on airway responses and inflammation to allergen in asthma. Am J Respir Crit Care Med. 2007 Mar 1;175(5):450-7. Epub 2006 Dec 14. | ||||
| Ref 529789 | J Med Chem. 2008 Nov 27;51(22):7094-8.cis-4-(Piperazin-1-yl)-5,6,7a,8,9,10,11,11a-octahydrobenzofuro[2,3-h]quinazolin-2-amine (A-987306), a new histamine H4R antagonist that blocks pain responses against carrageenan-induced hyperalgesia. | ||||
| Ref 530005 | J Med Chem. 2009 Apr 9;52(7):2148-52.Discovery of 6-({4-[2-(4-tert-butylphenyl)-1H-benzimidazol-4-yl]piperazin-1-yl}methyl)quinoxaline (WAY-207024): an orally active antagonist of the gonadotropin releasing hormone receptor (GnRH-R). | ||||
| Ref 531023 | J Med Chem. 2010 Aug 12;53(15):5491-501.Biological and conformational evaluation of bifunctional compounds for opioid receptor agonists and neurokinin 1 receptor antagonists possessing two penicillamines. | ||||
| Ref 531079 | J Med Chem. 2010 Sep 9;53(17):6386-97.Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 receptor agonist with unprecedented selectivity and procognitive potential. | ||||
| Ref 531732 | Tachykinin NK2 receptor antagonists. A patent review (2006 - 2010). Expert Opin Ther Pat. 2012 Jan;22(1):57-77. | ||||
| Ref 532668 | Antagonist profile of ibodutant at the tachykinin NK2 receptor in guinea pig isolated bronchi. Eur J Pharmacol. 2013 Oct 24. pii: S0014-2999(13)00788-7. | ||||
| Ref 533637 | Pharmacological characterization of a new class of nonpeptide neurokinin A antagonists that demonstrate species selectivity. J Pharmacol Exp Ther. 1995 Sep;274(3):1216-21. | ||||
| Ref 533690 | Characterization of the binding sites of [3H]SR 48968, a potent nonpeptide radioligand antagonist of the neurokinin-2 receptor. Biochem Biophys Res Commun. 1993 Mar 31;191(3):1172-7. | ||||
| Ref 533707 | GR159897, a potent non-peptide antagonist at tachykinin NK2 receptors. Eur J Pharmacol. 1995 Jan 16;272(2-3):241-8. | ||||
| Ref 533710 | Expression of rat NK-2 (neurokinin A) receptor in E. coli. Receptors Channels. 1994;2(4):295-302. | ||||
| Ref 533842 | MEN 10,627, a novel polycyclic peptide antagonist of tachykinin NK2 receptors. J Pharmacol Exp Ther. 1994 Dec;271(3):1489-500. | ||||
| Ref 533855 | Synthesis and characterization of selective fluorescent ligands for the neurokinin NK2 receptor. J Med Chem. 1994 Jun 24;37(13):1991-5. | ||||
| Ref 533929 | Characterisation, CNS distribution and function of NK2 receptors studied using potent NK2 receptor antagonists. Regul Pept. 1993 Jul 2;46(1-2):9-19. | ||||
| Ref 535777 | Antagonists at the neurokinin receptors--recent patent literature. IDrugs. 2003 Aug;6(8):758-72. | ||||
| Ref 535994 | Pharmacologic evaluation of neurokinin-2 receptor antagonists in the guinea pig respiratory tract. Am J Vet Res. 2004 Jul;65(7):984-91. | ||||
| Ref 536088 | Pharmacology of an original and selective nonpeptide antagonist ligand for the human tachykinin NK2 receptor. Eur J Pharmacol. 2005 Jun 1;516(2):104-11. | ||||
| Ref 536223 | Emerging drugs for the treatment of chronic obstructive pulmonary disease. Expert Opin Emerg Drugs. 2006 May;11(2):275-91. | ||||
| Ref 536224 | Emerging drugs for irritable bowel syndrome. Expert Opin Emerg Drugs. 2006 May;11(2):293-313. | ||||
| Ref 536765 | Occurrence and pharmacological characterization of four human tachykinin NK2 receptor variants. Biochem Pharmacol. 2008 Aug 15;76(4):476-81. Epub 2008 Jun 13. | ||||
| Ref 537079 | Multifaceted approach to determine the antagonist molecular mechanism and interaction of ibodutant ([1-(2-phenyl-1R-[[1-(tetrahydropyran-4-ylmethyl)-piperidin-4-ylmethyl]-carbamoyl]-ethylcarbamoyl)-cyclopentyl]-amide) at the human tachykinin NK2 receptor. J Pharmacol Exp Ther. 2009 May;329(2):486-95. Epub 2009 Feb 13. | ||||
| Ref 537293 | Characterization of species-related differences in the pharmacology of tachykinin NK receptors 1, 2 and 3. Biochem Pharmacol. 2009 May 1;77(9):1522-30. Epub 2009 Feb 6. | ||||
