Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T69912
|
||||
| Former ID |
TTDC00116
|
||||
| Target Name |
Lipoprotein-associated phospholipase A2
|
||||
| Gene Name |
PLA2G7
|
||||
| Synonyms |
1-alkyl-2-acetylglycerophosphocholine esterase; 2-acetyl-1-alkylglycerophosphocholine esterase; LDL-PLA(2); LDL-associated phospholipase A2; Lipoprotein-associated phospholipase A2; PAF 2-acylhydrolase; PAF acetylhydrolase; PLA2G7
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Arteriosclerosis [ICD9: 440; ICD10: I70] | ||||
| Alzheimer disease [ICD9: 331; ICD10: G30] | |||||
| Atherosclerosis [ICD9: 414.0, 440; ICD10: I70] | |||||
| Cardiovascular disorder [ICD10: I00-I99] | |||||
| Sepsis [ICD9: 995.91; ICD10: A40, A41] | |||||
| Function |
Modulates the action of platelet-activating factor (PAF) by hydrolyzing the sn-2 ester bond to yield the biologically inactive lyso-PAF. Has a specificity for substrates with a short residue at the sn-2 position. It is inactive against long-chain phospholipids.
|
||||
| BioChemical Class |
Carboxylic ester hydrolase
|
||||
| Target Validation |
T69912
|
||||
| UniProt ID | |||||
| EC Number |
EC 3.1.1.47
|
||||
| Sequence |
MVPPKLHVLFCLCGCLAVVYPFDWQYINPVAHMKSSAWVNKIQVLMAAASFGQTKIPRGN
GPYSVGCTDLMFDHTNKGTFLRLYYPSQDNDRLDTLWIPNKEYFWGLSKFLGTHWLMGNI LRLLFGSMTTPANWNSPLRPGEKYPLVVFSHGLGAFRTLYSAIGIDLASHGFIVAAVEHR DRSASATYYFKDQSAAEIGDKSWLYLRTLKQEEETHIRNEQVRQRAKECSQALSLILDID HGKPVKNALDLKFDMEQLKDSIDREKIAVIGHSFGGATVIQTLSEDQRFRCGIALDAWMF PLGDEVYSRIPQPLFFINSEYFQYPANIIKMKKCYSPDKERKMITIRGSVHQNFADFTFA TGKIIGHMLKLKGDIDSNVAIDLSNKASLAFLQKHLGLHKDFDQWDCLIEGDDENLIPGT NINTTNQHIMLQNSSGIEKYN |
||||
| Structure |
3D59; 3D5E; 3F96; 3F97; 3F98; 3F9C
|
||||
| Drugs and Mode of Action | |||||
| Drug(s) | GSK 659032 | Drug Info | Phase 1 | Cardiovascular disorder | [547694] |
| GSK2647544 | Drug Info | Phase 1 | Alzheimer disease | [524402] | |
| Rilapladib | Drug Info | Phase 1 | Arteriosclerosis | [542396], [547694] | |
| RPAF-AH | Drug Info | Discontinued in Phase 3 | Sepsis | [521515] | |
| Goxalapladib | Drug Info | Discontinued in Phase 1 | Arteriosclerosis | [547940] | |
| GSK568859 | Drug Info | Discontinued in Phase 1 | Atherosclerosis | [548491] | |
| Inhibitor | (1R)-1,2,2-TRIMETHYLPROPYL (R)-METHYLPHOSPHINATE | Drug Info | [551374] | ||
| (E)-(thiophen-2-ylmethylidene)amino benzoate | Drug Info | [527433] | |||
| 3,4-difluorobenzaldehyde O-benzoyloxime | Drug Info | [528384] | |||
| 4-fluorobenzaldehyde O-benzoyloxime | Drug Info | [528384] | |||
| Benzaldehyde O-benzoyloxime | Drug Info | [528384] | |||
| GSK 659032 | Drug Info | [537512] | |||
| Rilapladib | Drug Info | [1725884] | |||
| SB-381320 | Drug Info | [527433] | |||
| Modulator | Goxalapladib | Drug Info | [547941] | ||
| GSK2647544 | Drug Info | [543419] | |||
| GSK568859 | Drug Info | [543419] | |||
| RPAF-AH | Drug Info | [546181] | |||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Ether lipid metabolism | ||||
| Metabolic pathways | |||||
| Biosynthesis of antibiotics | |||||
| Pathway Interaction Database | Lissencephaly gene (LIS1) in neuronal migration and development | ||||
| WikiPathways | IL1 and megakaryotyces in obesity | ||||
| Synthesis, Secretion, and Deacylation of Ghrelin | |||||
| References | |||||
| Ref 521515 | ClinicalTrials.gov (NCT00037687) Safety and Efficacy of Recombinant Human Platelet-Activating Factor Acetylhydrolase for the Treatment of Severe Sepsis. U.S. National Institutes of Health. | ||||
| Ref 524402 | ClinicalTrials.gov (NCT01924858) A Positron Emission Tomography (PET) Study to Investigate the Brain Biodistribution of 18F GSK2647544 in Healthy Subjects to Determine Its Ability to Cross the Blood-brain-barrier.. U.S. National Institutes of Health. | ||||
| Ref 542396 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7376). | ||||
| Ref 547694 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800018454) | ||||
| Ref 527433 | Bioorg Med Chem Lett. 2005 Mar 1;15(5):1525-7.(E)-Phenyl- and -heteroaryl-substituted O-benzoyl-(or acyl)oximes as lipoprotein-associated phospholipase A2 inhibitors. | ||||
| Ref 528384 | Bioorg Med Chem Lett. 2006 Nov 1;16(21):5576-9. Epub 2006 Aug 21.Potent inhibitors of lipoprotein-associated phospholipase A(2): benzaldehyde O-heterocycle-4-carbonyloxime. | ||||
| Ref 543419 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1432). | ||||
| Ref 546181 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006777) | ||||
