Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T06273
|
||||
| Former ID |
TTDS00191
|
||||
| Target Name |
Poly [ADP-ribose] polymerase-1
|
||||
| Gene Name |
PARP1
|
||||
| Synonyms |
ADPRT; NAD(+) ADP-ribosyltransferase-1; NAD(+)Poly [ADP-ribose] polymerase-1 ADP-ribosyltransferase-1; PARP-1; Poly(ADP-ribose)polymerase-1; Poly[ADP-ribose] synthetase-1; PARP1
|
||||
| Target Type |
Successful
|
||||
| Disease | Ataxia telangiectasia [ICD10: G11.3] | ||||
| Brain ischaemia [ICD9: 435, 437; ICD10: G45.9, I67.8] | |||||
| Cerebrovascular disorders [ICD10: I60-I69] | |||||
| Cerebrovascular ischaemia [ICD9: 434.91; ICD10: I61-I63] | |||||
| Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
| Inflammatory skin condition [ICD10: L00-L99] | |||||
| Myocardial infarction [ICD9: 410; ICD10: I21, I22] | |||||
| Melanoma [ICD9: 172; ICD10: C43] | |||||
| Ovarian cancer [ICD9: 183; ICD10: C56] | |||||
| Permanent and transient stroke [ICD9: 434.91, 435.9; ICD10: G45.9, I61-I63] | |||||
| Recurrent epithelial ovarian or primary peritoneal cancer [ICD10: C78] | |||||
| Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48] | |||||
| Function |
Involved in the base excision repair (BER) pathway, by catalyzing the poly(ADP-ribosyl)ation of a limited number of acceptor proteins involved in chromatin architecture and in DNA metabolism. This modification follows DNA damages and appears as an obligatory step in a detection/signaling pathway leading to the reparation of DNA strand breaks. Mediates the poly(ADP- ribosyl)ation of APLF and CHFR. Positively regulates the transcription of MTUS1 and negatively regulates the transcription of MTUS2/TIP150. With EEF1A1 and TXK, forms a complex that acts as a T-helper 1 (Th1) cell-specific transcription factor and binds the promoter of IFN-gamma to directly regulate its transcription, and is thus involved importantly in Th1 cytokine production. Required for PARP9 and DTX3L recruitment to DNA damage sites. PARP1-dependent PARP9-DTX3L-mediated ubiquitination promotes the rapid and specific recruitment of 53BP1/TP53BP1, UIMC1/RAP80, and BRCA1 to DNA damage sites.
|
||||
| BioChemical Class |
Pentosyltransferase
|
||||
| Target Validation |
T06273
|
||||
| UniProt ID | |||||
| EC Number |
EC 2.4.2.30
|
||||
| Sequence |
MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKV
GHSIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGIGSKAEKTLGDFAAEYAKS NRSTCKGCMEKIEKGQVRLSKKMVDPEKPQLGMIDRWYHPGCFVKNREELGFRPEYSASQ LKGFSLLATEDKEALKKQLPGVKSEGKRKGDEVDGVDEVAKKKSKKEKDKDSKLEKALKA QNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSG QLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKVKKQDRIFPPE TSASVAATPPPSTASAPAAVNSSASADKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLT GTANKASLCISTKKEVEKMNKKMEEVKEANIRVVSEDFLQDVSASTKSLQELFLAHILSP WGAEVKAEPVEVVAPRGKSGAALSKKSKGQVKEEGINKSEKRMKLTLKGGAAVDPDSGLE HSAHVLEKGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIGSNK LEQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLEIDYGQDEEAVKKLTVNPG TKSKLPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAYSILSEVQQAV SQGSSDSQILDLSNRFYTLIPHDFGMKKPPLLNNADSVQAKVEMLDNLLDIEVAYSLLRG GSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIE REGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA NISLDGVDVPLGTGISSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFNFKTSLW |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | KU-0058948 | Drug Info | Approved | Ovarian cancer | [533123] |
| Nicotinamide | Drug Info | Approved | Inflammatory skin condition | [538965], [551997] | |
| Niraparib Tosylate | Drug Info | Approved | Recurrent epithelial ovarian or primary peritoneal cancer | [889446] | |
| Nicaraven | Drug Info | Phase 3 | Cerebrovascular disorders | [528516] | |
| AG140699 | Drug Info | Phase 2 | Melanoma | [551838] | |
| Intravenous minocycline | Drug Info | Phase 2 | Cerebrovascular ischaemia | [531185] | |
| CPH-102 | Drug Info | Preclinical | Cancer | [546143] | |
| NU1025 | Drug Info | Terminated | Discovery agent | [546083] | |
| PD-128763 | Drug Info | Terminated | Discovery agent | [545238] | |
| Inhibitor | (E)-N-(4-Phenylthiazol-2-yl) cinnamamide | Drug Info | [529901] | ||
| 1,2,3,4,4a,5-hexahydrophenanthridin-6(10bH)-one | Drug Info | [529901] | |||
| 1,7,8,9-tetrahydro-1,5-diaza-trindene-4,6-dione | Drug Info | [527871] | |||
| 2,3-dihydro-1H-benzo[de]isoquinolin-1-one | Drug Info | [530584] | |||
| 2,8-Dimethyl-3H-quinazolin-4-one | Drug Info | [534774] | |||
| 2-(2-Chlorophenyl)-2H-indazole-7-carboxamide | Drug Info | [530485] | |||
| 2-(3'-Methoxyphenyl) Benzimidazole-4-Carboxamide | Drug Info | [551374] | |||
| 2-(3-Chlorophenyl)-2H-indazole-7-carboxamide | Drug Info | [530485] | |||
| 2-(3-Piperidin-1-yl-propyl)-3H-quinazolin-4-one | Drug Info | [527159] | |||
| 2-(4-Amino-phenyl)-8-hydroxy-3H-quinazolin-4-one | Drug Info | [534774] | |||
| 2-(4-Amino-phenyl)-8-methyl-3H-quinazolin-4-one | Drug Info | [534774] | |||
| 2-(4-Azido-phenyl)-8-methoxy-3H-quinazolin-4-one | Drug Info | [534774] | |||
| 2-(4-Chlorophenyl)-2H-indazole-7-carboxamide | Drug Info | [530485] | |||
| 2-(4-Chlorophenyl)-5-Quinoxalinecarboxamide | Drug Info | [551393] | |||
| 2-(4-Hydroxy-phenyl)-8-methyl-3H-quinazolin-4-one | Drug Info | [534774] | |||
| 2-(4-Methoxy-phenyl)-8-methyl-3H-quinazolin-4-one | Drug Info | [534774] | |||
| 2-(4-methoxyphenyl)quinoline-8-carboxamide | Drug Info | [529894] | |||
| 2-Benzyl-2H-indazole-7-carboxamide | Drug Info | [530485] | |||
| 2-ethylquinoline-8-carboxamide | Drug Info | [529894] | |||
| 2-Methylquinoline-8-carboxamide | Drug Info | [529894] | |||
| 2-phenyl-2H-benzo[d][1,2,3]triazole-4-carboxamide | Drug Info | [530485] | |||
| 2-phenyl-2H-indazole-7-carboxamide | Drug Info | [530485] | |||
| 2-phenylpyrazolo-[1,5-a]pyridine-7-carboxamide | Drug Info | [530485] | |||
| 2-phenylquinoline-8-carboxamide | Drug Info | [529894] | |||
| 2H-Isoquinolin-1-one | Drug Info | [534774] | |||
| 3,4-Dihydro-5-Methyl-Isoquinolinone | Drug Info | [551393] | |||
| 3-(4-aminophenyl)quinoxaline-5-carboxamide | Drug Info | [529901] | |||
| 3-(4-cyanophenyl)quinoxaline-5-carboxamide | Drug Info | [529901] | |||
| 3-(4-methoxyphenyl)quinoxaline-5-carboxamide | Drug Info | [529901] | |||
| 3-Amino-benzamide | Drug Info | [534774] | |||
| 3-aminobenzamide | Drug Info | [535095] | |||
| 3-aminobenzo[c][1,5]naphthyridin-6(5H)-one | Drug Info | [529901] | |||
| 3-Ethenylquinoline-8-carboxamide | Drug Info | [529894] | |||
| 3-Ethylquinoline-8-carboxamide | Drug Info | [529894] | |||
| 3-Ethynylquinoline-8-carboxamide | Drug Info | [529894] | |||
| 3-Hydroxy-benzamide | Drug Info | [534774] | |||
| 3-Methoxybenzamide | Drug Info | [551393] | |||
| 3-Methylquinoline-8-carboxamide | Drug Info | [529894] | |||
| 3-Morpholin-4-ylmethyl-5H-phenanthridin-6-one | Drug Info | [527682] | |||
| 3-Phenylquinoline-8-carboxamide | Drug Info | [529894] | |||
| 3-Prop-1-ynylquinoline-8-carboxamide | Drug Info | [529894] | |||
| 4-(4-Morpholin-4-yl-butyl)-2H-phthalazin-1-one | Drug Info | [527682] | |||
| 4-(5-Morpholin-4-yl-pentyl)-2H-phthalazin-1-one | Drug Info | [527682] | |||
| 4-amino-1,8-naphthalimide | Drug Info | [527871] | |||
| 4-benzylphthalazin-1(2H)-one | Drug Info | [529901] | |||
| 4-methylpyrrolo[3,4-c]carbazole-1,3(2H,6H)-dione | Drug Info | [527871] | |||
| 5-amino-3,4-dihydroisoquinolin-1(2H)-one | Drug Info | [530584] | |||
| 5-aminoisoquinolin-1(2H)-one | Drug Info | [529894] | |||
| 5-Chloro-2-methyl-3H-quinazolin-4-one | Drug Info | [527159] | |||
| 5-methylpyrrolo[3,4-c]carbazole-1,3(2H,6H)-dione | Drug Info | [527871] | |||
| 6-AMINO-BENZO[DE]ISOQUINOLINE-1,3-DIONE | Drug Info | [551374] | |||
| 8-Amino-6H,11H-indeno[1,2-c]isoquinolin-5-one | Drug Info | [527674] | |||
| 8-Fluoro-6H,11H-indeno[1,2-c]isoquinolin-5-one | Drug Info | [527674] | |||
| 8-Hydroxy-2-(4-nitro-phenyl)-3H-quinazolin-4-one | Drug Info | [534774] | |||
| 8-Hydroxy-2-phenyl-3H-quinazolin-4-one | Drug Info | [534774] | |||
| 8-Methoxy-2-(4-nitro-phenyl)-3H-quinazolin-4-one | Drug Info | [534774] | |||
| 8-Methoxy-2-methyl-3H-quinazolin-4-one | Drug Info | [534774] | |||
| 8-Methoxy-2-phenyl-3H-quinazolin-4-one | Drug Info | [534774] | |||
| 8-Methyl-2-(4-nitro-phenyl)-3H-quinazolin-4-one | Drug Info | [534774] | |||
| 8-Methyl-2-phenyl-3H-quinazolin-4-one | Drug Info | [534774] | |||
| 8-Nitro-6H,11H-indeno[1,2-c]isoquinolin-5-one | Drug Info | [527674] | |||
| 9-Amino-6H,11H-indeno[1,2-c]isoquinolin-5-one | Drug Info | [527674] | |||
| 9-Fluoro-6H,11H-indeno[1,2-c]isoquinolin-5-one | Drug Info | [527674] | |||
| A-620223 | Drug Info | [543709] | |||
| AG-014376 | Drug Info | [527248] | |||
| AG140699 | Drug Info | [536077] | |||
| AG14361 | Drug Info | [526503] | |||
| ANG-2684 | Drug Info | [543709] | |||
| ANG-2864 | Drug Info | [543709] | |||
| Benzo[c][1,5]naphthyridin-6(5H)-one | Drug Info | [529901] | |||
| BPI-704001 | Drug Info | [543709] | |||
| BZ3 | Drug Info | [535762] | |||
| BZ5 | Drug Info | [535762] | |||
| BZ6 | Drug Info | [535762] | |||
| Carba-Nicotinamide-Adenine-Dinucleotide | Drug Info | [551393] | |||
| CEP-6800 | Drug Info | [528503] | |||
| CPH-102 | Drug Info | [543709] | |||
| DR2313 | Drug Info | [536077] | |||
| EB-47 | Drug Info | [536077] | |||
| HYDAMTIQ | Drug Info | [543709] | |||
| INO-1002 | Drug Info | [543709] | |||
| KR-33889 | Drug Info | [543709] | |||
| KU-0058948 | Drug Info | [530062] | |||
| KU-58684 | Drug Info | [529901] | |||
| ME0328 | Drug Info | [532533] | |||
| N-(4-Phenylthiazol-2-yl)isonicotinamide | Drug Info | [529901] | |||
| NU1025 | Drug Info | [551374] | |||
| PD-128763 | Drug Info | [534774] | |||
| PJ34 | Drug Info | [535095] | |||
| Pyrrolo[3,4-c]carbazole-1,3(2H,6H)-dione | Drug Info | [527871] | |||
| Pyrrolo[3,4-e]indole-1,3(2H,6H)-dione | Drug Info | [527871] | |||
| Quinoline-8-carboxamide | Drug Info | [529894] | |||
| S-070 | Drug Info | [543709] | |||
| S-111 | Drug Info | [543709] | |||
| Thieno-phenanthridin-6-one | Drug Info | [536077] | |||
| TI1 | Drug Info | [535762] | |||
| TI3 | Drug Info | [535762] | |||
| TI4 | Drug Info | [535762] | |||
| Modulator | Intravenous minocycline | Drug Info | [531185] | ||
| Nicaraven | Drug Info | [528516] | |||
| Niraparib Tosylate | Drug Info | [556264] | |||
| Binder | Nicotinamide | Drug Info | [537191] | ||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Base excision repair | ||||
| NF-kappa B signaling pathway | |||||
| PANTHER Pathway | FAS signaling pathway | ||||
| Pathway Interaction Database | Integrin-linked kinase signaling | ||||
| Caspase Cascade in Apoptosis | |||||
| Notch-mediated HES/HEY network | |||||
| Reactome | Dual Incision in GG-NER | ||||
| WikiPathways | FAS pathway and Stress induction of HSP regulation | ||||
| SMAD4 heterotrimer | |||||
| Nanoparticle triggered regulated necrosis | |||||
| Corticotropin-releasing hormone | |||||
| References | |||||
| Ref 528516 | Inhibition of poly (ADP-ribose) polymerase as a protective effect of nicaraven in ionizing radiation- and ara-C-induced cell death. Anticancer Res. 2006 Sep-Oct;26(5A):3421-7. | ||||
| Ref 531185 | Minocycline protects cardiac myocytes against simulated ischemia-reperfusion injury by inhibiting poly(ADP-ribose) polymerase-1. J Cardiovasc Pharmacol. 2010 Dec;56(6):659-68. | ||||
| Ref 538965 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1588). | ||||
| Ref 545238 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002552) | ||||
| Ref 546083 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006270) | ||||
| Ref 526503 | Tricyclic benzimidazoles as potent poly(ADP-ribose) polymerase-1 inhibitors. J Med Chem. 2003 Jan 16;46(2):210-3. | ||||
| Ref 527159 | J Med Chem. 2004 Aug 12;47(17):4151-4.Rational approaches to discovery of orally active and brain-penetrable quinazolinone inhibitors of poly(ADP-ribose)polymerase. | ||||
| Ref 527248 | J Med Chem. 2004 Oct 21;47(22):5467-81.Design, synthesis, and evaluation of 3,4-dihydro-2H-[1,4]diazepino[6,7,1-hi]indol-1-ones as inhibitors of poly(ADP-ribose) polymerase. | ||||
| Ref 527674 | J Med Chem. 2005 Aug 11;48(16):5100-3.Discovery of potent poly(ADP-ribose) polymerase-1 inhibitors from the modification of indeno[1,2-c]isoquinolinone. | ||||
| Ref 527682 | Bioorg Med Chem Lett. 2005 Oct 1;15(19):4221-5.4-Phenyl-1,2,3,6-tetrahydropyridine, an excellent fragment to improve the potency of PARP-1 inhibitors. | ||||
| Ref 527871 | Bioorg Med Chem Lett. 2006 Feb 15;16(4):938-42. Epub 2005 Nov 15.Synthesis and structure-activity relationships of novel poly(ADP-ribose) polymerase-1 inhibitors. | ||||
| Ref 528503 | Bioorg Med Chem Lett. 2007 Jan 15;17(2):542-5. Epub 2006 Oct 10.Novel poly(ADP-ribose) polymerase-1 inhibitors. | ||||
| Ref 528516 | Inhibition of poly (ADP-ribose) polymerase as a protective effect of nicaraven in ionizing radiation- and ara-C-induced cell death. Anticancer Res. 2006 Sep-Oct;26(5A):3421-7. | ||||
| Ref 529894 | J Med Chem. 2009 Feb 12;52(3):868-77.Design, synthesis, and evaluation in vitro of quinoline-8-carboxamides, a new class of poly(adenosine-diphosphate-ribose)polymerase-1 (PARP-1) inhibitor. | ||||
| Ref 529901 | J Med Chem. 2009 Feb 12;52(3):718-25.Design, synthesis, and cytoprotective effect of 2-aminothiazole analogues as potent poly(ADP-ribose) polymerase-1 inhibitors. | ||||
| Ref 530062 | J Med Chem. 2009 May 14;52(9):3108-11.Structural basis for inhibitor specificity in human poly(ADP-ribose) polymerase-3. | ||||
| Ref 530485 | J Med Chem. 2009 Nov 26;52(22):7170-85.Discovery of 2-{4-[(3S)-piperidin-3-yl]phenyl}-2H-indazole-7-carboxamide (MK-4827): a novel oral poly(ADP-ribose)polymerase (PARP) inhibitor efficacious in BRCA-1 and -2 mutant tumors. | ||||
| Ref 530584 | Bioorg Med Chem Lett. 2010 Jan 15;20(2):448-52. Epub 2009 Dec 4.Discovery and SAR of novel, potent and selective hexahydrobenzonaphthyridinone inhibitors of poly(ADP-ribose)polymerase-1 (PARP-1). | ||||
| Ref 531185 | Minocycline protects cardiac myocytes against simulated ischemia-reperfusion injury by inhibiting poly(ADP-ribose) polymerase-1. J Cardiovasc Pharmacol. 2010 Dec;56(6):659-68. | ||||
| Ref 532533 | Chemical probes to study ADP-ribosylation: synthesis and biochemical evaluation of inhibitors of the human ADP-ribosyltransferase ARTD3/PARP3. J Med Chem. 2013 Dec 12;56(23):9556-68. | ||||
| Ref 534774 | J Med Chem. 1998 Dec 17;41(26):5247-56.Resistance-modifying agents. 5. Synthesis and biological properties of quinazolinone inhibitors of the DNA repair enzyme poly(ADP-ribose) polymerase (PARP). | ||||
| Ref 535095 | Diabetic endothelial dysfunction: the role of poly(ADP-ribose) polymerase activation. Nat Med. 2001 Jan;7(1):108-13. | ||||
| Ref 535762 | Identification of potent nontoxic poly(ADP-Ribose) polymerase-1 inhibitors: chemopotentiation and pharmacological studies. Clin Cancer Res. 2003 Jul;9(7):2711-8. | ||||
| Ref 536077 | Poly(ADP-ribose) polymerase and the therapeutic effects of its inhibitors. Nat Rev Drug Discov. 2005 May;4(5):421-40. | ||||
| Ref 537191 | beta-1,2,3-Triazolyl-nucleosides as nicotinamide riboside mimics. Nucleosides Nucleotides Nucleic Acids. 2009 Mar;28(3):238-59. | ||||
