Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T20761
|
||||
| Former ID |
TTDNS00542
|
||||
| Target Name |
Vascular endothelial growth factor A
|
||||
| Gene Name |
VEGFA
|
||||
| Synonyms |
VEGF-A; Vascular permeability factor; VPF; VEGFA
|
||||
| Target Type |
Successful
|
||||
| Disease | Colorectal cancer [ICD9: 153, 154; ICD10: C18-C21] | ||||
| Exudative age-related macular degeneration [ICD9: 362.5; ICD10: H35.3] | |||||
| Lateral sclerosis [ICD10: G12.2] | |||||
| Macular degeneration [ICD9: 362.5; ICD10: H35.3] | |||||
| Metastatic colorectal cancer [ICD9: 153, 154; ICD10: C18-C21] | |||||
| Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48] | |||||
| Function |
Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. NRP1/Neuropilin-1 binds isoforms VEGF-165 and VEGF-145. Isoform VEGF165B binds to KDR but does not activate downstream signaling pathways, does not activate angiogenesis and inhibits tumor growth. .
|
||||
| BioChemical Class |
PDGF VEGF growth factor
|
||||
| UniProt ID | |||||
| Sequence |
MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVD
IFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEM SFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPG PHPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Aflibercept | Drug Info | Approved | Metastatic colorectal cancer | [551871] |
| PTC299 | Drug Info | Phase 2 | Solid tumours | [522680] | |
| RG7221 | Drug Info | Phase 2 | Colorectal cancer | [549449] | |
| RO5520985 | Drug Info | Phase 2 | Colorectal cancer | [889398] | |
| SNN-0029 | Drug Info | Phase 1/2 | Lateral sclerosis | [523531] | |
| MP-0112 | Drug Info | Phase 1 | Macular degeneration | [522910] | |
| SFLT-01 | Drug Info | Phase 1 | Macular degeneration | [522879] | |
| Bevasiranib | Drug Info | Discontinued in Phase 3 | Exudative age-related macular degeneration | [550053] | |
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Ras signaling pathway | ||||
| Rap1 signaling pathway | |||||
| Cytokine-cytokine receptor interaction | |||||
| HIF-1 signaling pathway | |||||
| mTOR signaling pathway | |||||
| PI3K-Akt signaling pathway | |||||
| VEGF signaling pathway | |||||
| Focal adhesion | |||||
| Pathways in cancer | |||||
| Proteoglycans in cancer | |||||
| MicroRNAs in cancer | |||||
| Renal cell carcinoma | |||||
| Pancreatic cancer | |||||
| Bladder cancer | |||||
| Rheumatoid arthritis | |||||
| NetPath Pathway | IL2 Signaling Pathway | ||||
| EGFR1 Signaling Pathway | |||||
| TGF_beta_Receptor Signaling Pathway | |||||
| TSH Signaling Pathway | |||||
| Leptin Signaling Pathway | |||||
| FSH Signaling Pathway | |||||
| PANTHER Pathway | Angiogenesis | ||||
| VEGF signaling pathway | |||||
| Pathway Interaction Database | Glypican 1 network | ||||
| HIF-2-alpha transcription factor network | |||||
| Beta3 integrin cell surface interactions | |||||
| S1P3 pathway | |||||
| Signaling events mediated by TCPTP | |||||
| S1P1 pathway | |||||
| Alpha9 beta1 integrin signaling events | |||||
| Integrins in angiogenesis | |||||
| VEGFR1 specific signals | |||||
| HIF-1-alpha transcription factor network | |||||
| Reactome | Platelet degranulation | ||||
| Regulation of gene expression by Hypoxia-inducible Factor | |||||
| VEGF ligand-receptor interactions | |||||
| VEGF binds to VEGFR leading to receptor dimerization | |||||
| WikiPathways | SIDS Susceptibility Pathways | ||||
| Hypertrophy Model | |||||
| Endochondral Ossification | |||||
| Focal Adhesion | |||||
| Differentiation Pathway | |||||
| Bladder Cancer | |||||
| Regulation of Hypoxia-inducible Factor (HIF) by Oxygen | |||||
| Nifedipine Activity | |||||
| Aryl Hydrocarbon Receptor | |||||
| Quercetin and Nf-kB/ AP-1 Induced Cell Apoptosis | |||||
| Integrated Pancreatic Cancer Pathway | |||||
| Oncostatin M Signaling Pathway | |||||
| Allograft Rejection | |||||
| Integrated Breast Cancer Pathway | |||||
| Signaling by VEGF | |||||
| Heart Development | |||||
| Angiogenesis | |||||
| References | |||||
| Ref 522680 | ClinicalTrials.gov (NCT00911248) PTC299 for Treatment of Neurofibromatosis Type 2. U.S. National Institutes of Health. | ||||
| Ref 522879 | ClinicalTrials.gov (NCT01024998) Safety and Tolerability Study of AAV2-sFLT01 in Patients With Neovascular Age-Related Macular Degeneration (AMD). U.S. National Institutes of Health. | ||||
| Ref 522910 | ClinicalTrials.gov (NCT01042678) Study of MP0112 Intravitreal Injection in Patients With Diabetic Macular Edema. U.S. National Institutes of Health. | ||||
| Ref 523531 | ClinicalTrials.gov (NCT01384162) An Open Label, Safety and Tolerability Continuation Study of Intracerebroventricular Administration of sNN0029 to Patients With Amyotrophic Lateral Sclerosis. U.S. National Institutes of Health. | ||||
| Ref 549449 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800037469) | ||||
| Ref 531341 | sFLT01: a novel fusion protein with antiangiogenic activity. Mol Cancer Ther. 2011 Mar;10(3):404-15. | ||||
| Ref 532834 | Treatment of exudative age-related macular degeneration with a designed ankyrin repeat protein that binds vascular endothelial growth factor: a phase I/II study. Am J Ophthalmol. 2014 Oct;158(4):724-732.e2. | ||||
