Target General Infomation
Target ID
T22095
Former ID
TTDC00214
Target Name
Interleukin-17
Gene Name
IL17A
Synonyms
CTLA-8; Cytotoxic T lymphocyte-associated antigen 8; IL-17; IL-17A; IL17A
Target Type
Successful
Disease Asthma [ICD10: J45]
Arthritis [ICD9: 710-719; ICD10: M00-M25]
Psoriatic arthritis [ICD9: 696; ICD10: L40.5, M07]
Psoriasis [ICD9: 696; ICD10: L40]
Plaque psoriasis [ICD10: L00-L99]
Rheumatoid arthritis [ICD9: 710-719, 714; ICD10: M05-M06]
Severe plaque psoriasis [ICD10: L40]
Function
Induces stromal cells to produce proinflammatory and hematopoietic cytokines. Enhances the surface expression of ICAM1/intracellular adhesion molecule 1 in fibroblasts.
BioChemical Class
Cytokine: interleukin
Target Validation
T22095
UniProt ID
Sequence
MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNP
KRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEIL
VLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Drugs and Mode of Action
Drug(s) Brodalumab Drug Info Approved Severe plaque psoriasis [889446]
Ixekizumab Drug Info Approved Plaque psoriasis [889440]
Brodalumab Drug Info Phase 3 Psoriasis [524588], [542542]
Ixekizumab Drug Info Phase 3 Psoriatic arthritis [523694], [542543]
ABT-122 Drug Info Phase 2 Rheumatoid arthritis [525076], [889413]
Brodalumab Drug Info Phase 2 Asthma [542542], [550248]
CNTO-6785 Drug Info Phase 2 Rheumatoid arthritis [524385]
COVA322 Drug Info Phase 1/2a Psoriasis [889403]
ALX-0761 Drug Info Phase 1 Psoriasis [889400]
SCH-900117 Drug Info Phase 1 Rheumatoid arthritis [548886]
RG-4934 Drug Info Discontinued in Phase 1 Arthritis [549128]
Modulator ABT-122 Drug Info
ALX-0761 Drug Info [889442]
Brodalumab Drug Info [556264]
COVA322 Drug Info [889442]
Ixekizumab Drug Info [532056], [532704]
SCH-900117 Drug Info [525390]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
KEGG Pathway Cytokine-cytokine receptor interaction
Inflammatory bowel disease (IBD)
Rheumatoid arthritis
NetPath Pathway TCR Signaling Pathway
PANTHER Pathway Interleukin signaling pathway
Pathway Interaction Database IL27-mediated signaling events
IL23-mediated signaling events
WikiPathways TCR Signaling Pathway
Allograft Rejection
IL17 signaling pathway
References
Ref 523694ClinicalTrials.gov (NCT01474512) A Phase 3 Study in Participants With Moderate to Severe Psoriasis. U.S. National Institutes of Health.
Ref 524385ClinicalTrials.gov (NCT01909427) An Efficacy And Safety Study of CNTO 6785 In Participants With Active Rheumatoid Arthritis Despite Methotrexate Therapy. U.S. National Institutes of Health.
Ref 524588ClinicalTrials.gov (NCT02029495) Study of Efficacy, Safety and Effect on Radiographic Progession of Brodalumab in Subjects With Psoriatic Arthritis. U.S. National Institutes of Health.
Ref 525076ClinicalTrials.gov (NCT02349451) A Phase 2 Study to Investigate the Safety, Tolerability and Efficacy of ABT-122 in Subjects With Active Psoriatic Arthritis Who Have an Inadequate Response to Methotrexate. U.S. National Institutes of Health.
Ref 542542(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7540).
Ref 542543(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7541).
Ref 548886Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800029914)
Ref 549128Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800032677)
Ref 550248Amgen And AstraZeneca Announce Positive Results From Second Pivotal Phase 3 Study Of Brodalumab In Patients With Moderate-To-Severe Plaque Psoriasis
Ref 889400ClinicalTrials.gov (NCT02156466) Multiple Ascending Dose Trial of MSB0010841 (Anti-IL17A/F Nanobody) in Psoriasis Subjects
Ref 889403ClinicalTrials.gov (NCT02243787) Safety and Tolerability Study of COVA322 in Patients With Stable Chronic Moderate-to-severe Plaque Psoriasis
Ref 889413ClinicalTrials.gov (NCT02433340) Phase 2, Multicenter, Open-Label Extension (OLE) Study With ABT-122 in Rheumatoid Arthritis Subjects Who Have Completed the Preceding M12-963 Study
Ref 8894402016 FDA drug approvals. Nat Rev Drug Discov. 2017 Feb 2;16(2):73-76. doi: 10.1038/nrd.2017.14.
Ref 889446Drugs@FDA (Edaravone)
Ref 525390Targeting IL-17 and TH17 cells in chronic inflammation. Nat Rev Drug Discov. 2012 Oct;11(10):763-76. doi: 10.1038/nrd3794.
Ref 525413Targeting the IL-17-T(H)17 pathway. Nat Rev Drug Discov. 2015 Jan;14(1):11-2. doi: 10.1038/nrd4518.
Ref 532056Brodalumab and ixekizumab, anti-interleukin-17-receptor antibodies for psoriasis: a critical appraisal. Br J Dermatol. 2012 Oct;167(4):710-3; discussion 714-5.
Ref 532704A phase II randomized study of subcutaneous ixekizumab, an anti-interleukin-17 monoclonal antibody, in rheumatoid arthritis patients who were naive to biologic agents or had an inadequate response totumor necrosis factor inhibitors. Arthritis Rheumatol. 2014 Jul;66(7):1693-704.
Ref 549127Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800032677)
Ref 556264Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
Ref 889442Bispecific antibodies rise again. Nat Rev Drug Discov. 2014 Nov;13(11):799-801. doi: 10.1038/nrd4478.
Ref 1587926URL: https://www.ebi.ac.uk/chembl/ The ChEMBL database in 2017