Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T22095
|
||||
| Former ID |
TTDC00214
|
||||
| Target Name |
Interleukin-17
|
||||
| Gene Name |
IL17A
|
||||
| Synonyms |
CTLA-8; Cytotoxic T lymphocyte-associated antigen 8; IL-17; IL-17A; IL17A
|
||||
| Target Type |
Successful
|
||||
| Disease | Asthma [ICD10: J45] | ||||
| Arthritis [ICD9: 710-719; ICD10: M00-M25] | |||||
| Psoriasis [ICD9: 696; ICD10: L40] | |||||
| Plaque psoriasis [ICD10: L00-L99] | |||||
| Psoriatic arthritis [ICD9: 696; ICD10: L40.5, M07] | |||||
| Rheumatoid arthritis [ICD9: 710-719, 714; ICD10: M05-M06] | |||||
| Severe plaque psoriasis [ICD10: L40] | |||||
| Function |
Induces stromal cells to produce proinflammatory and hematopoietic cytokines. Enhances the surface expression of ICAM1/intracellular adhesion molecule 1 in fibroblasts.
|
||||
| BioChemical Class |
Cytokine: interleukin
|
||||
| Target Validation |
T22095
|
||||
| UniProt ID | |||||
| Sequence |
MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNP
KRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEIL VLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Brodalumab | Drug Info | Approved | Severe plaque psoriasis | [889446] |
| Ixekizumab | Drug Info | Approved | Plaque psoriasis | [889440] | |
| Brodalumab | Drug Info | Phase 3 | Psoriasis | [524588], [542542] | |
| Ixekizumab | Drug Info | Phase 3 | Psoriatic arthritis | [523694], [542543] | |
| ABT-122 | Drug Info | Phase 2 | Rheumatoid arthritis | [525076], [889413] | |
| Brodalumab | Drug Info | Phase 2 | Asthma | [542542], [550248] | |
| CNTO-6785 | Drug Info | Phase 2 | Rheumatoid arthritis | [524385] | |
| COVA322 | Drug Info | Phase 1/2a | Psoriasis | [889403] | |
| ALX-0761 | Drug Info | Phase 1 | Psoriasis | [889400] | |
| SCH-900117 | Drug Info | Phase 1 | Rheumatoid arthritis | [548886] | |
| RG-4934 | Drug Info | Discontinued in Phase 1 | Arthritis | [549128] | |
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Cytokine-cytokine receptor interaction | ||||
| Inflammatory bowel disease (IBD) | |||||
| Rheumatoid arthritis | |||||
| NetPath Pathway | TCR Signaling Pathway | ||||
| PANTHER Pathway | Interleukin signaling pathway | ||||
| Pathway Interaction Database | IL27-mediated signaling events | ||||
| IL23-mediated signaling events | |||||
| WikiPathways | TCR Signaling Pathway | ||||
| Allograft Rejection | |||||
| IL17 signaling pathway | |||||
| References | |||||
| Ref 523694 | ClinicalTrials.gov (NCT01474512) A Phase 3 Study in Participants With Moderate to Severe Psoriasis. U.S. National Institutes of Health. | ||||
| Ref 524385 | ClinicalTrials.gov (NCT01909427) An Efficacy And Safety Study of CNTO 6785 In Participants With Active Rheumatoid Arthritis Despite Methotrexate Therapy. U.S. National Institutes of Health. | ||||
| Ref 524588 | ClinicalTrials.gov (NCT02029495) Study of Efficacy, Safety and Effect on Radiographic Progession of Brodalumab in Subjects With Psoriatic Arthritis. U.S. National Institutes of Health. | ||||
| Ref 525076 | ClinicalTrials.gov (NCT02349451) A Phase 2 Study to Investigate the Safety, Tolerability and Efficacy of ABT-122 in Subjects With Active Psoriatic Arthritis Who Have an Inadequate Response to Methotrexate. U.S. National Institutes of Health. | ||||
| Ref 542542 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7540). | ||||
| Ref 542543 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7541). | ||||
| Ref 548886 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800029914) | ||||
| Ref 549128 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800032677) | ||||
| Ref 550248 | Amgen And AstraZeneca Announce Positive Results From Second Pivotal Phase 3 Study Of Brodalumab In Patients With Moderate-To-Severe Plaque Psoriasis | ||||
| Ref 889400 | ClinicalTrials.gov (NCT02156466) Multiple Ascending Dose Trial of MSB0010841 (Anti-IL17A/F Nanobody) in Psoriasis Subjects | ||||
| Ref 889403 | ClinicalTrials.gov (NCT02243787) Safety and Tolerability Study of COVA322 in Patients With Stable Chronic Moderate-to-severe Plaque Psoriasis | ||||
| Ref 889413 | ClinicalTrials.gov (NCT02433340) Phase 2, Multicenter, Open-Label Extension (OLE) Study With ABT-122 in Rheumatoid Arthritis Subjects Who Have Completed the Preceding M12-963 Study | ||||
| Ref 525390 | Targeting IL-17 and TH17 cells in chronic inflammation. Nat Rev Drug Discov. 2012 Oct;11(10):763-76. doi: 10.1038/nrd3794. | ||||
| Ref 525413 | Targeting the IL-17-T(H)17 pathway. Nat Rev Drug Discov. 2015 Jan;14(1):11-2. doi: 10.1038/nrd4518. | ||||
| Ref 532056 | Brodalumab and ixekizumab, anti-interleukin-17-receptor antibodies for psoriasis: a critical appraisal. Br J Dermatol. 2012 Oct;167(4):710-3; discussion 714-5. | ||||
| Ref 532704 | A phase II randomized study of subcutaneous ixekizumab, an anti-interleukin-17 monoclonal antibody, in rheumatoid arthritis patients who were naive to biologic agents or had an inadequate response totumor necrosis factor inhibitors. Arthritis Rheumatol. 2014 Jul;66(7):1693-704. | ||||
| Ref 549127 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800032677) | ||||
