Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T30085
|
||||
| Former ID |
TTDNC00579
|
||||
| Target Name |
SLGT2
|
||||
| Gene Name |
SLC5A2
|
||||
| Synonyms |
Low affinity sodium-glucose cotransporter; Na(+)/glucose cotransporter 2; Sodium/glucose cotransporter 2; Solute carrier family 5 member 2; SLC5A2
|
||||
| Target Type |
Successful
|
||||
| Disease | Diabetes [ICD9: 253.5, 588.1; ICD10: E23.2, N25.1] | ||||
| Liver disease [ICD9: 570-574; ICD10: K70-K77] | |||||
| Type 2 diabetes [ICD9: 250; ICD10: E11] | |||||
| Type 1 diabetes [ICD9: 250; ICD10: E10] | |||||
| Function |
Efficient substrate transport in mammalian kidney is provided by the concerted action of a low affinity high capacity and a high affinity low capacity Na(+)/glucose cotransporter arranged in series along kidney proximal tubules.
|
||||
| BioChemical Class |
Solute:sodium symporter
|
||||
| UniProt ID | |||||
| Sequence |
MEEHTEAGSAPEMGAQKALIDNPADILVIAAYFLLVIGVGLWSMCRTNRGTVGGYFLAGR
SMVWWPVGASLFASNIGSGHFVGLAGTGAASGLAVAGFEWNALFVVLLLGWLFAPVYLTA GVITMPQYLRKRFGGRRIRLYLSVLSLFLYIFTKISVDMFSGAVFIQQALGWNIYASVIA LLGITMIYTVTGGLAALMYTDTVQTFVILGGACILMGYAFHEVGGYSGLFDKYLGAATSL TVSEDPAVGNISSFCYRPRPDSYHLLRHPVTGDLPWPALLLGLTIVSGWYWCSDQVIVQR CLAGKSLTHIKAGCILCGYLKLTPMFLMVMPGMISRILYPDEVACVVPEVCRRVCGTEVG CSNIAYPRLVVKLMPNGLRGLMLAVMLAALMSSLASIFNSSSTLFTMDIYTRLRPRAGDR ELLLVGRLWVVFIVVVSVAWLPVVQAAQGGQLFDYIQAVSSYLAPPVSAVFVLALFVPRV NEQGAFWGLIGGLLMGLARLIPEFSFGSGSCVQPSACPAFLCGVHYLYFAIVLFFCSGLL TLTVSLCTAPIPRKHLHRLVFSLRHSKEEREDLDADEQQGSSLPVQNGCPESAMEMNEPQ APAPSLFRQCLLWFCGMSRGGVGSPPPLTQEEAAAAARRLEDISEDPSWARVVNLNALLM MAVAVFLWGFYA |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Canagliflozin | Drug Info | Approved | Type 2 diabetes | [467821], [532651], [532916] |
| Dapagliflozin | Drug Info | Approved | Type 2 diabetes | [467834], [533123] | |
| Dapagliflozin Propanediol; Saxagliptin Hydrochloride | Drug Info | Approved | Type 2 diabetes | [889446] | |
| Empagliflozin | Drug Info | Approved | Type 1 diabetes | [467995], [533123] | |
| ASP1941 | Drug Info | Phase 3 | Liver disease | [522923] | |
| PF-04971729 | Drug Info | Phase 3 | Type 2 diabetes | [524892] | |
| AVE-2268 | Drug Info | Phase 2 | Diabetes | [521866] | |
| Canagliflozin | Drug Info | Phase 2 | Type 2 diabetes | [467821], [551060] | |
| LX-4211 | Drug Info | Phase 2 | Type 2 diabetes | [524151], [543064] | |
| RO-4998452 | Drug Info | Phase 2 | Type 2 diabetes | [522503] | |
| YM-543 | Drug Info | Phase 2 | Type 2 diabetes | [521996] | |
| BI-44847 | Drug Info | Phase 1 | Type 2 diabetes | [524868] | |
| EGT-0001474 | Drug Info | Phase 1 | Type 2 diabetes | [522600] | |
| TS-033 | Drug Info | Discontinued in Phase 2 | Diabetes | [548084] | |
| Modulator | ASP1941 | Drug Info | |||
| AVE-2268 | Drug Info | [529915] | |||
| BI-44847 | Drug Info | ||||
| Canagliflozin | Drug Info | [532651], [532916] | |||
| Dapagliflozin | Drug Info | [533123] | |||
| Dapagliflozin Propanediol; Saxagliptin Hydrochloride | Drug Info | [556264] | |||
| EGT-0001474 | Drug Info | ||||
| Empagli ozin | Drug Info | [533123] | |||
| Empagliflozin | Drug Info | [533123] | |||
| LX-4211 | Drug Info | [531953] | |||
| PF-04971729 | Drug Info | ||||
| RO-4998452 | Drug Info | ||||
| TS-033 | Drug Info | ||||
| YM-543 | Drug Info | ||||
| Inhibitor | sergliflozin | Drug Info | [528482] | ||
| Pathways | |||||
| References | |||||
| Ref 467821 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4582). | ||||
| Ref 467834 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4594). | ||||
| Ref 467995 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4754). | ||||
| Ref 521866 | ClinicalTrials.gov (NCT00361738) Dose-Ranging Study Evaluating AVE2268 in Patients With Type 2 Diabetes Not Adequately Controlled by a Metformin Treatment. U.S. National Institutes of Health. | ||||
| Ref 521996 | ClinicalTrials.gov (NCT00454233) A Safety and Efficacy Study With YM543 in Type 2 Diabetes Mellitus Subjects. U.S. National Institutes of Health. | ||||
| Ref 522503 | ClinicalTrials.gov (NCT00800176) A Dose-Finding Study of RO4998452 in Patients With Diabetes Mellitus. U.S. National Institutes of Health. | ||||
| Ref 522600 | ClinicalTrials.gov (NCT00854113) Study to Determine the Safety, Tolerability, and Pharmacokinetic (PK) Profile of EGT0001474 in Healthy Volunteers. U.S. National Institutes of Health. | ||||
| Ref 522923 | ClinicalTrials.gov (NCT01054092) A Study to Assess the Long-term Safety and Efficacy of ASP1941 in Japanese Diabetic Patients. U.S. National Institutes of Health. | ||||
| Ref 524151 | ClinicalTrials.gov (NCT01742208) Safety and Efficacy of LX4211 in Patients With Inadequately Controlled Type 1 Diabetes Mellitus. U.S. National Institutes of Health. | ||||
| Ref 524868 | ClinicalTrials.gov (NCT02211937) Relative Oral Bioavailability of BI 44847 as Suspension Compared to Tablet and the Influence of Food Anf of BI 44847 as Solution Compared to Tablet in Healthy Male Volunteers. U.S. National Institutes of Health. | ||||
| Ref 524892 | ClinicalTrials.gov (NCT02226003) Efficacy and Safety of Ertugliflozin (MK-8835/PF-04971729) With Sitagliptin in the Treatment of Participants With Type 2 Diabetes Mellitus (T2DM) With Inadequate Glycemic Control on Diet and Exercise (MK-8835-017). U.S. National Institutes of Health. | ||||
| Ref 532916 | Canagliflozin, a sodium glucose co-transporter 2 inhibitor, reduces post-meal glucose excursion in patients with type 2 diabetes by a non-renal mechanism: results of a randomized trial. Metabolism. 2014 Oct;63(10):1296-303. | ||||
| Ref 543064 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8312). | ||||
| Ref 528482 | Sergliflozin, a novel selective inhibitor of low-affinity sodium glucose cotransporter (SGLT2), validates the critical role of SGLT2 in renal glucose reabsorption and modulates plasma glucose level. J Pharmacol Exp Ther. 2007 Jan;320(1):323-30. Epub 2006 Oct 18. | ||||
| Ref 529915 | Effects of AVE2268, a substituted glycopyranoside, on urinary glucose excretion and blood glucose in mice and rats. Arzneimittelforschung. 2008;58(11):574-80. | ||||
| Ref 531953 | LX4211, a dual SGLT1/SGLT2 inhibitor, improved glycemic control in patients with type 2 diabetes in a randomized, placebo-controlled trial. Clin Pharmacol Ther. 2012 Aug;92(2):158-69. | ||||
